KEGG   Homo sapiens (human): 390148Help
Entry
390148            CDS       T01001                                 

Gene name
OR5W2, OR5W2P, OR5W3P
Definition
(RefSeq) olfactory receptor family 5 subfamily W member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    390148 (OR5W2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    390148 (OR5W2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    390148 (OR5W2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390148
NCBI-ProteinID: NP_001001960
HGNC: 15299
Ensembl: ENSG00000187612
Vega: OTTHUMG00000166818
Pharos: Q8NH69(Tdark)
UniProt: Q8NH69
Position
11q12.1
AA seq 310 aa AA seqDB search
MDWENCSSLTDFFLLGITNNPEMKVTLFAVFLAVYIINFSANLGMIVLIRMDYQLHTPMY
FFLSHLSFCDLCYSTATGPKMLVDLLAKNKSIPFYGCALQFLVFCIFADSECLLLSVMAF
DRYKAIINPLLYTVNMSSRVCYLLLTGVYLVGIADALIHMTLAFRLCFCGSNEINHFFCD
IPPLLLLSRSDTQVNELVLFTVFGFIELSTISGVFISYCYIILSVLEIHSAEGRFKALST
CTSHLSAVAIFQGTLLFMYFRPSSSYSLDQDKMTSLFYTLVVPMLNPLIYSLRNKDVKEA
LKKLKNKILF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggactgggaaaattgctcctcattaactgatttttttctcttgggaattaccaataac
ccagagatgaaagtgaccctatttgctgtattcttggctgtttatatcattaatttctca
gcaaatcttggaatgatagttttaatcagaatggattaccaacttcacacaccaatgtat
ttcttcctcagtcatctgtctttctgtgatctctgctattctactgcaactgggcccaag
atgctggtagatctacttgccaagaacaagtcaatacccttctatggctgtgctctgcaa
ttcttggtcttctgtatctttgcagattctgagtgtctactgctgtcagtgatggccttt
gatcggtacaaggccatcatcaaccccctgctctatacagtcaacatgtctagcagagtg
tgctatctactcttgactggggtttatctggtgggaatagcagatgctttgatacatatg
acactggccttccgcctatgcttctgtgggtctaatgagattaatcatttcttctgtgat
atccctcctctcttattactctctcgctcagatacacaggtcaatgagttagtgttattc
accgtctttggttttattgaactgagtaccatttcaggagttttcatttcttattgttat
atcatcctatcagtcttggagatacactctgctgaggggaggttcaaagctctctctaca
tgcacttcccacttatctgcggttgcaattttccagggaactctgctctttatgtatttc
cggccaagttcttcctattctctagatcaagataaaatgacctcattgttttacaccctt
gtggttcccatgttgaaccccctgatttatagcctgaggaacaaggatgtgaaagaggcc
ctgaaaaaactgaaaaataaaattttattttaa

DBGET integrated database retrieval system