KEGG   Homo sapiens (human): 390197Help
Entry
390197            CDS       T01001                                 

Gene name
OR4D10, OR11-251, OR4D10P, OST711
Definition
(RefSeq) olfactory receptor family 4 subfamily D member 10
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    390197 (OR4D10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    390197 (OR4D10)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    390197 (OR4D10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390197
NCBI-ProteinID: NP_001004705
HGNC: 15173
Ensembl: ENSG00000254466
Vega: OTTHUMG00000167341
Pharos: Q8NGI6(Tdark)
UniProt: Q8NGI6 A0A126GVJ1
Position
11q12.1
AA seq 311 aa AA seqDB search
MEMENCTRVKEFIFLGLTQNREVSLVLFLFLLLVYVTTLLGNLLIMVTVTCESRLHTPMY
FLLHNLSIADICFSSITVPKVLVDLLSERKTISFNHCFTQMFLFHLIGGVDVFSLSVMAL
DRYVAISKPLHYATIMSRDHCIGLTVAAWLGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VHRVLKLAHTDIFILELLMISNNGLLTTLWFFLLLVSYIVILSLPKSQAGEGRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPMDKAISVTFTVISPLLNPLIYTLRNHEMKSAMRR
LKRRLVPSDRK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaaaactgcaccagggtaaaagaatttattttccttggcctgacccagaat
cgggaagtgagcttagtcttatttcttttcctactcttggtgtatgtgacaactttgctg
ggaaacctcctcatcatggtcactgttacctgtgaatctcgccttcacacgcccatgtat
tttttgctccataatttatctattgccgatatctgcttctcttccatcacagtgcccaag
gttctggtggaccttctgtctgaaagaaagaccatctccttcaatcattgcttcactcag
atgtttctattccaccttattggaggggtggatgtattttctctttcggtgatggcattg
gatcgatatgtggccatctccaagcccctgcactatgcgactatcatgagtagagaccat
tgcattgggctcacagtggctgcctggttggggggctttgtccactccatcgtgcagatt
tccctgttgctcccactccctttctgcggacccaatgttcttgacactttctactgtgat
gtccaccgggtcctcaaactggcccatacagacattttcatacttgaactactaatgatt
tccaacaatggactgctcaccacactgtggtttttcctgctcctggtgtcctacatagtc
atattatcattacccaagtctcaggcaggagagggcaggaggaaagccatctccacctgc
acctcccacatcactgtggtgaccctgcatttcgtgccctgcatctatgtctatgcccgg
cccttcactgccctccccatggataaggccatctctgtcaccttcactgtcatctcccct
ctgctcaaccccttgatctacactctgaggaaccatgagatgaagtcagccatgaggaga
ctgaagagaagacttgtgccttctgatagaaaatag

DBGET integrated database retrieval system