KEGG   Homo sapiens (human): 3902Help
Entry
3902              CDS       T01001                                 

Gene name
LAG3, CD223
Definition
(RefSeq) lymphocyte activating 3
  KO
K06565  lymphocyte-activation gene 3 protein
Organism
hsa  Homo sapiens (human)
Drug target
Relatlimab: D11350
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3902 (LAG3)
CD molecules [BR:hsa04090]
 Proteins
  3902 (LAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig Ig_2 I-set Izumo-Ig Ig_6 Trypan_PARP stn_TNFRSF12A TarH
Motif
Other DBs
NCBI-GeneID: 3902
NCBI-ProteinID: NP_002277
OMIM: 153337
HGNC: 6476
Ensembl: ENSG00000089692
Vega: OTTHUMG00000169197
Pharos: P18627(Tbio)
UniProt: P18627
Position
12p13.31
AA seq 525 aa AA seqDB search
MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAG
VTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRV
QLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLR
ASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWG
CILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP
PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGS
PGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERL
LGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRP
RRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaggctcagttcctgggcttgctgtttctgcagccgctttgggtggctccagtg
aagcctctccagccaggggctgaggtcccggtggtgtgggcccaggagggggctcctgcc
cagctcccctgcagccccacaatccccctccaggatctcagccttctgcgaagagcaggg
gtcacttggcagcatcagccagacagtggcccgcccgctgccgcccccggccatcccctg
gcccccggccctcacccggcggcgccctcctcctgggggcccaggccccgccgctacacg
gtgctgagcgtgggtcccggaggcctgcgcagcgggaggctgcccctgcagccccgcgtc
cagctggatgagcgcggccggcagcgcggggacttctcgctatggctgcgcccagcccgg
cgcgcggacgccggcgagtaccgcgccgcggtgcacctcagggaccgcgccctctcctgc
cgcctccgtctgcgcctgggccaggcctcgatgactgccagccccccaggatctctcaga
gcctccgactgggtcattttgaactgctccttcagccgccctgaccgcccagcctctgtg
cattggttccggaaccggggccagggccgagtccctgtccgggagtccccccatcaccac
ttagcggaaagcttcctcttcctgccccaagtcagccccatggactctgggccctggggc
tgcatcctcacctacagagatggcttcaacgtctccatcatgtataacctcactgttctg
ggtctggagcccccaactcccttgacagtgtacgctggagcaggttccagggtggggctg
ccctgccgcctgcctgctggtgtggggacccggtctttcctcactgccaagtggactcct
cctgggggaggccctgacctcctggtgactggagacaatggcgactttacccttcgacta
gaggatgtgagccaggcccaggctgggacctacacctgccatatccatctgcaggaacag
cagctcaatgccactgtcacattggcaatcatcacagtgactcccaaatcctttgggtca
cctggatccctggggaagctgctttgtgaggtgactccagtatctggacaagaacgcttt
gtgtggagctctctggacaccccatcccagaggagtttctcaggaccttggctggaggca
caggaggcccagctcctttcccagccttggcaatgccagctgtaccagggggagaggctt
cttggagcagcagtgtacttcacagagctgtctagcccaggtgcccaacgctctgggaga
gccccaggtgccctcccagcaggccacctcctgctgtttctcatccttggtgtcctttct
ctgctccttttggtgactggagcctttggctttcacctttggagaagacagtggcgacca
agacgattttctgccttagagcaagggattcaccctccgcaggctcagagcaagatagag
gagctggagcaagaaccggagccggagccggagccggaaccggagcccgagcccgagccc
gagccggagcagctctga

DBGET integrated database retrieval system