KEGG   Homo sapiens (human): 390245Help
Entry
390245            CDS       T01001                                 

Gene name
KDM4E, JMJD2E, KDM4DL, KDM5E
Definition
(RefSeq) lysine demethylase 4E
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    390245 (KDM4E)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     390245 (KDM4E)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     390245 (KDM4E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    390245 (KDM4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC JmjN Cytochrome_cB
Motif
Other DBs
NCBI-GeneID: 390245
NCBI-ProteinID: NP_001155102
OMIM: 616581
HGNC: 37098
Ensembl: ENSG00000235268
Vega: OTTHUMG00000167858
Pharos: B2RXH2(Tchem)
UniProt: B2RXH2
Structure
PDB: 

Position
11q21
AA seq 506 aa AA seqDB search
MKSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQMY
DDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQ
RYWKSHPGNPPIYGADISGSLFEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKTWYVVPPEHGQHLERLARELFPDISRGCEAFLR
HKVALISPTVLKENGIPFNCMTQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDY
GKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQDLAIVEHTEPRVAESQELSNWRD
DIVLRRAALGLRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLT
LGMSARVLLPSTGSWGSGRGRGRGQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLL
MGTRSRAQGHRPQLPLANDLMTNLSL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgtgcactccagtccccagaacacgagtcataccatcatgacgttttaccca
accatggaagaatttgcagatttcaacacatatgttgcttacatggagtcccaaggcgca
catcaagctggccttgccaaggtaattccacccaaggaatggaaagccagacagatgtat
gatgatatcgaagacatcttaatagccactcccctccagcaggtgacctctgggcaggga
ggtgtgtttactcaataccataaaaagaagaaagccatgagggtggggcagtatcgccgc
ttggcaaacagtaaaaaatatcagactccgccacaccagaattttgcagatttggagcaa
cgatactggaagagccaccccggtaatccaccaatttatggtgctgatatcagcggctcc
ttatttgaagaaagcactaaacaatggaacctaggacacctgggaacaattctggacctg
ttggagcaggaatgtggggttgtcatcgagggtgtcaacacaccctacctgtactttggc
atgtggaagaccacgtttgcctggcacacagaggacatggacctttacagcatcaactac
ctgcactttggggagcccaaaacttggtacgtggtgcccccagaacatggtcagcacctg
gaacgcctggccagggagctcttcccagacatttctcggggctgtgaggccttcctgcgg
cacaaagtggccctcatctcgcctacagttctcaaggaaaatgggattcccttcaattgc
atgactcaggaggctggggagttcatggtgacctttccctatggctaccatgctggcttc
aatcacggcttcaactgcgcagaagccattaattttgccactccacgatggattgattat
ggcaaaatggcctctcagtgtagctgtggggagtcgacagtgaccttttccatggacccc
tttgtgcgcattgtgcaacccgagagttatgagctctggaaacacaggcaagacttggcc
attgtggaacacacagagcccagggttgcagaaagccaagagctgagcaactggagagat
gatatagtacttagaagagctgctctgggcctgaggcttctcccaaacctcacagcccag
tgtcccacacagcctgtgtcctcagggcactgttacaacccaaaaggctgtggcactgat
gctgtgcctggatccgcattccaaagctctgcatatcatacccagacccagtcacttacc
ctggggatgtcagccagggttcttctcccttccactggaagctggggttctggtcgtggt
cgtggtcgtggtcaaggtcaaggtcgaggttgcagtcgtggtcgtggtcatggttgttgt
actcgagaactggggactgaggagccaactgttcagcctgcatccaagaggcgcctttta
atgggtacaaggagtagagctcaaggccacaggcctcagctcccgcttgccaatgatttg
atgacaaatctgtccctttga

DBGET integrated database retrieval system