KEGG   Homo sapiens (human): 390259
Entry
390259            CDS       T01001                                 

Gene name
BSX, BSX1
Definition
(RefSeq) brain specific homeobox
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 390259
NCBI-ProteinID: NP_001091639
OMIM: 611074
HGNC: 20450
Ensembl: ENSG00000188909
Vega: OTTHUMG00000150247
Pharos: Q3C1V8(Tdark)
UniProt: Q3C1V8
Position
11q24.1
AA seq 233 aa
MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMP
TPTLLAPHAHHPLHKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDS
QLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAPD
GPESPEGSPRGSEAATAAEARLSLPAGPFVLTEPEDEVDIGDEGELGSGPHVL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaatctcaacttcacctctcctctacacccggcgtcttctcagaggcccacatccttc
ttcatcgaggacatcctgctgcacaagcccaagccgctgagagaggtggccccagaccat
ttcgccagctctctggcctctcgggtgcctctgctagactatggctaccccctcatgccc
acacccaccctcttggctcctcacgcccatcaccctctgcataagggagaccaccatcat
ccttatttcctcaccacctcggggatgccagtcccagcgctgttcccgcacccgcagcac
gcggagctgccggggaagcactgccgccgccgcaaagcccgcacggttttctctgactcg
cagctctcgggcttggagaagaggttcgagatccagcgctacctgtccacgccagaacga
gtggagctggccacggccctcagcctgtccgagacgcaggtgaaaacgtggttccagaac
cggcggatgaagcataaaaagcaactgcggaaaagccaagacgaacccaaagcaccagac
gggccagaaagccccgagggcagcccccgcggttcagaggccgccaccgccgccgaggct
cggctgagcctgcccgccggtcccttcgtgctgaccgagccagaggacgaggtggacatt
ggagacgagggggagctgggctcagggccgcacgtgctctga

DBGET integrated database retrieval system