KEGG   Homo sapiens (human): 390264
Entry
390264            CDS       T01001                                 

Gene name
OR10G4, OR11-278
Definition
(RefSeq) olfactory receptor family 10 subfamily G member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    390264 (OR10G4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    390264 (OR10G4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    390264 (OR10G4)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 390264
NCBI-ProteinID: NP_001004462
HGNC: 14809
Ensembl: ENSG00000254737
Vega: OTTHUMG00000165966
Pharos: Q8NGN3(Tdark)
UniProt: Q8NGN3 A0A126GWS5
Position
11q24.2
AA seq 311 aa
MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD
RYLAISYPLRYTSMMSGSRCALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDA
PPILKLACADTSANVMVIFVDIGIVASGCFVLIVLSYVSIVCSILRIRTSDGRRRAFQTC
ASHCIVVLCFFVPCVVIYLRPGSMDAMDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK
LRDKVAHPQRK
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtccaacgccagcctcgtgacagcattcatcctcacaggccttccccatgccccaggg
ctggacgccctcctctttggaatcttcctggtggtttacgtgctcactgtgctggggaac
ctcctcatcctgctggtgatcagggtggattctcacctccacacccccatgtactacttc
ctcaccaacctgtccttcattgacatgtggttctccactgtcacggtgcccaaaatgctg
atgaccttggtgtccccaagcggcagggctatctccttccacagctgcgtggctcagctc
tattttttccacttcctggggagcaccgagtgtttcctctacacagtcatgtcctatgat
cgctacttggccatcagttacccgctcaggtacaccagcatgatgagtgggagcaggtgt
gccctcctggccaccggcacttggctcagtggctctctgcactctgctgtccagaccata
ttgactttccatttgccctactgtggacccaaccagatccagcactacttctgtgacgca
ccgcccatcctgaaactggcctgtgcagacacctcagccaacgtgatggtcatctttgtg
gacattgggatagtggcctcaggctgctttgtcctgatagtgctgtcctatgtgtccatc
gtctgttccatcctgcggatccgcacctcagatgggaggcgcagagcctttcagacctgt
gcctcccactgtattgtggtcctttgcttctttgttccctgtgttgtcatttatctgagg
ccaggctccatggatgccatggatggagttgtggccattttctacactgtgctgacgccc
cttctcaaccctgttgtgtacaccctgagaaacaaggaggtgaagaaagctgtgttgaaa
cttagagacaaagtagcacatcctcagaggaaataa

DBGET integrated database retrieval system