KEGG   Homo sapiens (human): 390275
Entry
390275            CDS       T01001                                 

Gene name
OR8A1, OR11-318, OST025
Definition
(RefSeq) olfactory receptor family 8 subfamily A member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    390275 (OR8A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    390275 (OR8A1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    390275 (OR8A1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 390275
NCBI-ProteinID: NP_001005194
HGNC: 8469
Ensembl: ENSG00000196119
Vega: OTTHUMG00000165923
Pharos: Q8NGG7(Tdark)
UniProt: Q8NGG7
Position
11q24.2
AA seq 309 aa
MAAGNHSTVTEFILKGLTKRADLQLPLFLLFLGIYLVTIVGNLGMITLICLNSQLHTPMY
YFLSNLSLMDLCYSSVITPKMLVNFVSEKNIISYAGCMSQLYFFLVFVIAECYMLTVMAY
DRYVAICHPLLYNIIMSHHTCLLLVAVVYAIGLIGSTIETGLMLKLPYCEHLISHYFCDI
LPLMKLSCSSTYDVEMTVFFSAGFNIIVTSLTVLVSYTFILSSILGISTTEGRSKAFSTC
SSHLAAVGMFYGSTAFMYLKPSTISSLTQENVASVFYTTVIPMLNPLIYSLRNKEVKAAV
QKTLRGKLF
NT seq 930 nt   +upstreamnt  +downstreamnt
atggctgcaggaaatcactctacagtgacagagttcattctcaagggtttaacgaagaga
gcagacctccagctccccctctttctcctcttcctcgggatctacttggtcaccatcgtg
gggaacctgggcatgatcactctaatttgtctgaactctcagctgcacacccccatgtac
tactttctcagcaatctgtcactcatggatctctgctactcctccgtcattacccctaag
atgctggtgaactttgtgtcagagaaaaacatcatctcctacgcagggtgcatgtcacag
ctctacttcttccttgtttttgtcattgctgagtgttacatgctgacagtgatggcctac
gaccgctatgttgccatctgccaccctttgctttacaacatcattatgtctcatcacacc
tgcctgctgctggtggctgtggtctacgccatcggactcattggctccacaatagaaact
ggcctcatgttaaaactgccctattgtgagcacctcatcagtcactacttctgtgacatc
ctccctctcatgaagctgtcctgctctagcacctatgatgttgagatgacagtcttcttt
tcggctggattcaacatcatagtcacgagcttaacagttcttgtttcttacaccttcatt
ctctccagcatcctcggcatcagcaccacagaggggagatccaaagccttcagcacctgc
agctcccaccttgcagccgtgggaatgttctatggatcaactgcattcatgtacttaaaa
ccctccacaatcagttccttgacccaggagaatgtggcctctgtgttctacaccacggta
atccccatgttgaatcccctaatctacagcctgaggaacaaggaagtaaaggctgccgtg
cagaaaacgctgaggggtaaactgttttga

DBGET integrated database retrieval system