KEGG   Homo sapiens (human): 3904Help
Entry
3904              CDS       T01001                                 

Gene name
LAIR2, CD306
Definition
(RefSeq) leukocyte associated immunoglobulin like receptor 2
  KO
K06725  leukocyte-associated Ig-like receptor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3904 (LAIR2)
CD molecules [BR:hsa04090]
 Proteins
  3904 (LAIR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig
Motif
Other DBs
NCBI-GeneID: 3904
NCBI-ProteinID: NP_002279
OMIM: 602993
HGNC: 6478
Ensembl: ENSG00000167618
Vega: OTTHUMG00000065697
Pharos: Q6ISS4(Tbio)
UniProt: Q6ISS4
Position
19q13.42
AA seq 152 aa AA seqDB search
MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRL
EREDRAKYKDSYNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLV
KESSGGPDSPDTEPGSSAGTVPGTEASGFDAP
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtctccacacctcactgctctcctgggcctagtgctctgcctggcccagaccatccac
acgcaggagggggcccttcccagaccctccatctcggctgagccaggcactgtgatctcc
ccggggagccatgtgactttcatgtgccggggcccggttggggttcaaacattccgcctg
gagagggaggatagagccaagtacaaagatagttataatgtgtttcgacttggtccatct
gagtcagaggccagattccacattgactcagtaagtgaaggaaatgccgggctttatcgc
tgcctctattataagccccctggatggtctgagcacagtgacttcctggagctgctggtg
aaagaaagctctggaggcccggactccccggacacagagcccggctcctcagctgggact
gtgccaggcactgaagcctccggatttgatgcaccatga

DBGET integrated database retrieval system