KEGG   Homo sapiens (human): 390441Help
Entry
390441            CDS       T01001                                 

Gene name
OR11H7, OR11H7P
Definition
(RefSeq) olfactory receptor family 11 subfamily H member 7 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    390441 (OR11H7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    390441 (OR11H7)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    390441 (OR11H7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 390441
NCBI-ProteinID: NP_001335202
HGNC: 15350
Vega: OTTHUMG00000170851
UniProt: Q8NGC8
Position
14q11.2
AA seq 314 aa AA seqDB search
MNNSQISTVTQFVLLGFPGPWKIQIIFFSMILLVYIFTLTGNMAIICAVRWDHRLHTPMY
VLLANFSFLEIWYVTCTVPNMLVNFFSKTKTISFSGCFTQFHFFFSLGTTECFFLCVMAY
DRYLAICHPLHYPSIMTGQLCGILVSLCWLIGFLGHSISIFFIFQLPFCGPNIIDHFLCD
VDPLMALSSAPTHIIGHVFHSVSSLFINLTMVYILGSYTLVLRTVLQVPSSAGWQKAIST
CGSHLVVVSLFYGAIMLMYVSPTPGNSVAMHKLITLIYSVVTPVLNPLIYSLRNKDMKYA
LHHVFCGMRIIQRS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaataactcacagatatctactgtgacgcagtttgtgttgttggggtttcctggtccc
tggaaaattcagatcatctttttctcaatgattttgttggtctacatcttcactctgact
gggaatatggccatcatctgtgcagtgaggtgggaccatcgactccatacccctatgtac
gtgctcctagccaacttctccttcctagagatctggtatgtgacctgcacagtccccaac
atgctggtaaattttttctccaaaactaagaccatatcattctctggatgtttcactcag
ttccacttcttcttttccctgggcacaactgaatgcttcttcctctgtgtcatggcttat
gatcggtacctggccatctgccacccactgcactatccctccattatgactggccagctc
tgtggcatcttggtgtctctttgttggctcattggtttccttggacattcaatttccatt
ttcttcatttttcaactacctttctgtggtcccaacatcattgatcattttctgtgtgat
gtagacccactgatggcattgtcctctgcccctactcacatcatagggcatgtgttccat
tctgtgagctctcttttcatcaacctcaccatggtgtacatccttgggtcctataccttg
gtgctcagaactgtgcttcaggttccttcttcagctggatggcaaaaggccatctctacc
tgtgggtcacacttggttgttgtgtctctgttctatggagccataatgctgatgtatgtg
agtcccacacctggcaactcagttgctatgcataagctcatcacactgatatattctgtg
gtaacacctgtcttaaaccccctcatctacagcctacgcaacaaggacatgaaatatgcc
ctccatcatgtcttctgtggaatgagaattatccagagatcatga

DBGET integrated database retrieval system