KEGG   Homo sapiens (human): 390442
Entry
390442            CDS       T01001                                 

Gene name
OR11H4, OR14-36
Definition
(RefSeq) olfactory receptor family 11 subfamily H member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    390442 (OR11H4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    390442 (OR11H4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    390442 (OR11H4)
SSDB
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Other DBs
NCBI-GeneID: 390442
NCBI-ProteinID: NP_001004479
HGNC: 15347
Ensembl: ENSG00000176198
Vega: OTTHUMG00000170852
Pharos: Q8NGC9(Tdark)
UniProt: Q8NGC9 A0A126GW19
Position
14q11.2
AA seq 314 aa
MNRSATHIVTEFILLGFPGCWKIQIFLFSLFLVIYVLTLLGNGAIIYAVRCNPLLHTPMY
FLLGNFAFLEIWYVSSTIPNMLVNILSKTKAISFSGCFLQFYFFFSLGTTECLFLAVMAY
DRYLAICHPLQYPAIMTVRFCGKLVSFCWLIGFLGYPIPIFYISQLPFCGPNIIDHFLCD
MDPLMALSCAPAPITECIFYTQSSLVLFFTSMYILRSYILLLTAVFQVPSAAGRRKAFST
CGSHLVVVSLFYGTVMVMYVSPTYGIPTLLQKILTLVYSVTTPLFNPLIYTLRNKDMKLA
LRNVLFGMRIRQNS
NT seq 945 nt   +upstreamnt  +downstreamnt
atgaacaggtcagcaacacacatcgtgacagagtttattctcctgggattccctggttgc
tggaagattcagattttcctcttctcattgtttttggtgatttatgtcttgaccttgctg
ggaaatggagccatcatctatgcagtgagatgcaacccactactacacacccccatgtac
tttctgctgggaaattttgccttccttgagatctggtatgtgtcctccactattcctaac
atgctagtcaacattctctccaagaccaaggccatctcattttctgggtgcttcctccag
ttctatttcttcttttcactgggaacaactgaatgtctctttctggcagtaatggcttat
gatcgatacctggccatctgccacccactgcagtaccctgccatcatgactgtaaggttc
tgtggtaagctggtgtctttctgttggcttattggattccttggatacccaattcccatt
ttctacatctcccaactccccttctgtggtcctaatatcattgatcacttcctgtgtgac
atggacccattgatggctctatcctgtgccccagctcccataactgaatgtattttctat
actcagagctcccttgtcctctttttcactagtatgtacattcttcgatcctatatcctg
ttactaacagctgtttttcaggtcccttctgcagctggtcggagaaaagccttctctacc
tgtggttctcatttggttgtggtatctcttttctatgggacagtcatggtaatgtatgta
agtcctacatatgggatcccaactttattgcagaagatcctcacactggtatattcagta
acgactcctctttttaatcctctgatctatactcttcgtaataaggacatgaaactcgct
ctgagaaatgtcctgtttggaatgagaattcgtcaaaattcgtga

DBGET integrated database retrieval system