KEGG   Homo sapiens (human): 3906Help
Entry
3906              CDS       T01001                                 

Gene name
LALBA, LYZG
Definition
(RefSeq) lactalbumin alpha
  KO
K00704  alpha-lactalbumin [EC:2.4.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00052  Galactose metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    3906 (LALBA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     3906 (LALBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys
Motif
Other DBs
NCBI-GeneID: 3906
NCBI-ProteinID: NP_002280
OMIM: 149750
HGNC: 6480
Ensembl: ENSG00000167531
Vega: OTTHUMG00000170391
Pharos: P00709(Tbio)
UniProt: P00709 A0A080YV01
Structure
PDB: 

Position
12q13.11
AA seq 142 aa AA seqDB search
MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAI
VENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGI
DYWLAHKALCTEKLEQWLCEKL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctttgtccctctgttcctggtgggcatcctgttccctgccatcctggccaag
caattcacaaaatgtgagctgtcccagctgctgaaagacatagatggttatggaggcatc
gctttgcctgaattgatctgtaccatgtttcacaccagtggttatgacacacaagccata
gttgaaaacaatgaaagcacggaatatggactcttccagatcagtaataagctttggtgc
aagagcagccaggtccctcagtcaaggaacatctgtgacatctcctgtgacaagttcctg
gatgatgacattactgatgacataatgtgtgccaagaagatcctggatattaaaggaatt
gactactggttggcccataaagccctctgcactgagaagctggaacagtggctttgtgag
aagttgtga

DBGET integrated database retrieval system