KEGG   Homo sapiens (human): 390792
Entry
390792            CDS       T01001                                 

Gene name
KRT39, CK-39, K39, KA35
Definition
(RefSeq) keratin 39
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    390792 (KRT39)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    390792 (KRT39)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    390792 (KRT39)
   04147 Exosome [BR:hsa04147]
    390792 (KRT39)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     390792 (KRT39)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   390792 (KRT39)
  Exosomal proteins of other body fluids (saliva and urine)
   390792 (KRT39)
  Exosomal proteins of colorectal cancer cells
   390792 (KRT39)
  Exosomal proteins of melanoma cells
   390792 (KRT39)
SSDB
Motif
Pfam: Filament
Other DBs
NCBI-GeneID: 390792
NCBI-ProteinID: NP_998821
OMIM: 616678
HGNC: 32971
Ensembl: ENSG00000196859
Vega: OTTHUMG00000133424
Pharos: Q6A163(Tdark)
UniProt: Q6A163
Position
17q21.2
AA seq 491 aa
MDTKGCTTTNSPSTPCQNCSRITNVSTISSNNGCHPGGLTVNNCQPAGHVLRIPWDQGCQ
PTPRFCRKPIYLMNNFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERE
NAELESKIQEESNKELPVLCPDYLSYYTTIEELQQKILCTKAENSRLVSQIDNTKLTADD
LRAKYEAEVSLRQLVESDANGLKQILNVLTLGKADLEAQVQSLKEELLCLKNNHKEEINS
LQCQLGERLDIEVTAAPSADLNQVLQEMRCQYEPIMETNRKDVEQWFNTQIEELNQQVVT
SSQQQQCCQKEIIELRRSVNTLEVELQAQHRMRDSQECILTETEARYTALLTQIQSLIDN
LEAQLAEIRCALERQNQEYEILLDVKSRLECEITTYRSLLESSDGKRPCYPRATKCEPSP
WTSCKSGAIESTAPACTSSSPCSLKEHCSACGPLSRILVKICTITKEIKDGKVISSYEHV
QPCFIIRPAKV
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggacaccaagggctgtacaacaaccaattctccttcaaccccatgtcaaaactgctct
aggattacaaatgttagtaccatctcttctaacaacggctgccatcctggtggccttaca
gtcaacaactgtcaaccagctggccacgttctcagaattccctgggaccagggctgccaa
cccactcctcgcttttgtcgcaagcccatctacctaatgaacaacttcaatgcccgtttt
tctctggatgactgcagctggtatggtgaaggcatcaacagtaatgagaaggagaccatg
caaatcttgaacgagcgccttgctaactacctgcaaaaggtgcgaatgctagaacgagag
aatgctgaactggaatctaaaatccaggaagaaagtaacaaagagctccctgttctatgt
cctgattacctgtcttactacactaccattgaggagctccagcagaagatcttgtgtacc
aaggccgagaattccagactggtctcgcaaattgacaacaccaaactgactgcagatgac
ttgagagccaaatacgaagctgaggtgtctctacgccagctggtagagtcagatgccaat
ggcctcaagcagatcctgaatgtgctgaccctgggcaaggccgacctagaggcacaagtc
cagtctctgaaagaggagctcctttgcctcaagaacaaccacaaagaggaaatcaattct
ttacagtgtcagcttggggagagacttgacattgaagtgactgctgccccttctgctgac
ctaaaccaggttctacaagaaatgagatgtcaatatgagcccatcatggagacaaaccgc
aaagatgtggaacagtggttcaacacgcagatagaggagctgaatcaacaagtggtgacc
agctctcaacagcagcaatgctgccaaaaggagatcatagaactgagacgcagtgtgaac
actctggaggttgaactgcaggcccagcatcgaatgagagattcccaagagtgcatccta
acggagacagaggctcgctacacggccttgctgacccagatccagagtctgattgataac
ctggaagctcagctggcagagatccggtgtgccctggaaagacagaaccaagaatacgag
atcctgctggacgtcaagtcccggctggaatgtgagattaccacataccgcagccttctg
gagagctcggatggcaagcgtccctgttacccacgtgccaccaaatgtgagccttcccct
tggacatcttgtaagtccggagccatagaaagcacggccccagcttgcacatcctcatcc
ccctgcagcttaaaggagcactgcagtgcctgcggacccctgtcccggatactggttaaa
atttgcaccatcaccaaggagattaaggatgggaaggtcatttcttcttacgagcatgtg
cagccttgtttcatcatcagacctgccaaagtctaa

DBGET integrated database retrieval system