KEGG   Homo sapiens (human): 3911Help
Entry
3911              CDS       T01001                                 

Gene name
LAMA5
Definition
(RefSeq) laminin subunit alpha 5
  KO
K06240  laminin, alpha 3/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa01100  Metabolic pathways
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3911 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3911 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3911 (LAMA5)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3911 (LAMA5)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    3911 (LAMA5)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    3911 (LAMA5)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    3911 (LAMA5)
   05145 Toxoplasmosis
    3911 (LAMA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_I Laminin_N Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 3911
NCBI-ProteinID: NP_005551
OMIM: 601033
HGNC: 6485
Ensembl: ENSG00000130702
Vega: OTTHUMG00000032908
Pharos: O15230(Tbio)
UniProt: O15230
Structure
PDB: 

Position
20q13.33
AA seq 3695 aa AA seqDB search
MAKRLCAGSALCVRGPRGPAPLLLVGLALLGAARAREEAGGGFSLHPPYFNLAEGARIAA
SATCGEEAPARGSPRPTEDLYCKLVGGPVAGGDPNQTIRGQYCDICTAANSNKAHPASNA
IDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGR
TYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPG
AMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
VCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCN
CYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPL
DSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSND
TREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCELCAPGFYGPGCQP
CQCSSPGVADDRCDPDTGQCRCRVGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCD
EAGRCLCQPEFAGPHCDRCRPGYHGFPNCQACTCDPRGALDQLCGAGGLCRCRPGYTGTA
CQECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRPRVTGLRCDTCVPGAYNFPYC
EAGSCHPAGLAPVDPALPEAQVPCMCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDL
RGTLGGVAECQPGTGQCFCKPHVCGQACASCKDGFFGLDQADYFGCRSCRCDIGGALGQS
CEPRTGVCRCRPNTQGPTCSEPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
FSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSATCANC
TAQSQPVAFPPSTEPAFITVPQRGFGEPFVLNPGTWALRVEAEGVLLDYVVLLPSAYYEA
ALLQLRVTEACTYRPSAQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQL
SPSHPPLITCTGSDVDVQLQVAVPQPGRYALVVEYANEDARQEVGVAVHTPQRAPQQGLL
SLHPCLYSTLCRGTARDTQDHLAVFHLDSEASVRLTAEQARFFLHGVTLVPIEEFSPEFV
EPRVSCISSHGAFGPNSAACLPSRFPKPPQPIILRDCQVIPLPPGLPLTHAQDLTPAMSP
AGPRPRPPTAVDPDAEPTLLREPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLIN
AGRVWQGHANASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPKGRWLWLDYVLVVP
ENVYSFGYLREEPLDKSYDFISHCAAQGYHISPSSSSLFCRNAAASLSLFYNNGARPCGC
HEVGATGPTCEPFGGQCPCHAHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCIC
PPRTIPPDCLLCQPQTFGCHPLVGCEECNCSGPGIQELTDPTCDTDSGQCKCRPNVTGRR
CDTCSPGFHGYPRCRPCDCHEAGTAPGVCDPLTGQCYCKENVQGPKCDQCSLGTFSLDAA
NPKGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSTDRQVVPHERQPGTEMLRADLRH
VPEAVPEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFVPMESRPDVVLQGN
QMSITFLEPAYPTPGHVHRGQLQLVEGNFRHTETRNTVSREELMMVLASLEQLQIRALFS
QISSAVFLRRVALEVASPAGQGALASNVELCLCPASYRGDSCQECAPGFYRDVKGLFLGR
CVPCQCHGHSDRCLPGSGVCVDCQHNTEGAHCERCQAGFVSSRDDPSAPCVSCPCPLSVP
SNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLL
FSDCDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCDCTPCGTEACDPHSGHC
LCKAGVTGRRCDRCQEGHFGFDGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCR
ECAPGYWGLPEQGCRRCQCPGGRCDPHTGRCNCPPGLSGERCDTCSQQHQVPVPGGPVGH
SIHCEVCDHCVVLLLDDLERAGALLPAIHEQLRGINASSMAWARLHRLNASIADLQSQLR
SPLGPRHETAQQLEVLEQQSTSLGQDARRLGGQAVGTRDQASQLLAGTEATLGHAKTLLA
AIRAVDRTLSELMSQTGHLGLANASAPSGEQLLRTLAEVERLLWEMRARDLGAPQAAAEA
ELAAAQRLLARVQEQLSSLWEENQALATQTRDRLAQHEAGLMDLREALNRAVDATREAQE
LNSRNQERLEEALQRKQELSRDNATLQATLHAARDTLASVFRLLHSLDQAKEELERLAAS
LDGARTPLLQRMQTFSPAGSKLRLVEAAEAHAQQLGQLALNLSSIILDVNQDRLTQRAIE
ASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQ
QRLGLVWAALQGARTQLRDVRAKKDQLEAHIQAAQAMLAMDTDETSKKIAHAKAVAAEAQ
DTATRVQSQLQAMQENVERWQGQYEGLRGQDLGQAVLDAGHSVSTLEKTLPQLLAKLSIL
ENRGVHNASLALSASIGRVRELIAQARGAASKVKVPMKFNGRSGVQLRTPRDLADLAAYT
ALKFYLQGPEPEPGQGTEDRFVMYMGSRQATGDYMGVSLRDKKVHWVYQLGEAGPAVLSI
DEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGG
YPSTFTPPPLLRFPGYRGCIEMDTLNEEVVSLYNFERTFQLDTAVDRPCARSKSTGDPWL
TDGSYLDGTGFARISFDSQISTTKRFEQELRLVSYSGVLFFLKQQSQFLCLAVQEGSLVL
LYDFGAGLKKAVPLQPPPPLTSASKAIQVFLLGGSRKRVLVRVERATVYSVEQDNDLELA
DAYYLGGVPPDQLPPSLRRLFPTGGSVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLL
VGRAMTFHGHGFLRLALSNVAPLTGNVYSGFGFHSAQDSALLYYRASPDGLCQVSLQQGR
VSLQLLRTEVKTQAGFADGAPHYVAFYSNATGVWLYVDDQLQQMKPHRGPPPELQPQPEG
PPRLLLGGLPESGTIYNFSGCISNVFVQRLLGPQRVFDLQQNLGSVNVSTGCAPALQAQT
PGLGPRGLQATARKASRRSRQPARHPACMLPPHLRTTRDSYQFGGSLSSHLEFVGILARH
RNWPSLSMHVLPRSSRGLLLFTARLRPGSPSLALFLSNGHFVAQMEGLGTRLRAQSRQRS
RPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSK
LPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATL
PDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVL
CDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPA
YCGCMRRLAVNRSPVAMTRSVEVHGAVGASGCPAA
NT seq 11088 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcggctctgcgcggggagcgcactgtgtgttcgcggcccccggggccccgcg
ccgctgctgctggtcgggctggcgctgctgggcgcggcgcgggcgcgggaggaggcgggc
ggcggcttcagcctgcacccgccctacttcaacctggccgagggcgcccgcatcgccgcc
tccgcgacctgcggagaggaggccccggcgcgcggctccccgcgccccaccgaggacctt
tactgcaagctggtagggggccccgtggccggcggcgaccccaaccagaccatccggggc
cagtactgtgacatctgcacggctgccaacagcaacaaggcacaccccgcgagcaatgcc
atcgatggcacggagcgctggtggcagagtccaccgctgtcccgcggcctggagtacaac
gaggtcaacgtcaccctggacctgggccaggtcttccacgtggcctacgtcctcatcaag
tttgccaactcaccccggccggacctctgggtgctggagcggtccatggacttcggccgc
acctaccagccctggcagttctttgcctcctccaagagggactgtctggagcggttcggg
ccacagacgctggagcgcatcacacgggacgacgcggccatctgcaccaccgagtactca
cgcatcgtgcccctggagaacggagagatcgtggtgtccctggtgaacggacgtccgggc
gccatgaatttctcctactcgccgctgctacgtgagttcaccaaggccaccaacgtccgc
ctgcgcttcctgcgtaccaacacgctgctgggccatctcatggggaaggcgctgcgggac
cccacggtcacccgccggtattattacagcatcaaggatatcagcatcggaggccgctgt
gtctgccacggccacgcggatgcctgcgatgccaaagaccccacggacccgttcaggctg
cagtgcacctgccagcacaacacctgcgggggcacctgcgaccgctgctgccccggcttc
aatcagcagccgtggaagcctgcgactgccaacagtgccaacgagtgccagtcctgtaac
tgctacggccatgccaccgactgttactacgaccctgaggtggaccggcgccgcgccagc
cagagcctggatggcacctatcagggtgggggtgtctgtatcgactgccagcaccacacc
accggcgtcaactgtgagcgctgcctgcccggcttctaccgctctcccaaccaccctctc
gactcgccccacgtctgccgccgctgcaactgcgagtccgacttcacggatggcacctgc
gaggacctgacgggtcgatgctactgccggcccaacttctctggggagcggtgtgacgtg
tgtgccgagggcttcacgggcttcccaagctgctacccgacgccctcgtcctccaatgac
accagggagcaggtgctgccagccggccagattgtgaattgtgactgcagcgcggcaggg
acccagggcaacgcctgccggaaggacccaagggtgggacgctgtctgtgcaaacccaac
ttccaaggcacccattgtgagctctgcgcgccagggttctacggccccggctgccagccc
tgccagtgttccagccctggagtggccgatgaccgctgtgaccctgacacaggccagtgc
aggtgccgagtgggcttcgagggggccacatgtgatcgctgtgcccccggctactttcac
ttccctctctgccagttgtgtggctgcagccctgcaggaaccttgcccgagggctgcgat
gaggccggccgctgcctatgccagcctgagtttgctggacctcattgtgaccggtgccgc
cctggctaccatggtttccccaactgccaagcatgcacctgcgaccctcggggagccctg
gaccagctctgtggggcgggaggtttgtgccgctgccgccccggctacacaggcactgcc
tgccaggaatgcagccccggctttcacggcttccccagctgtgtcccctgccactgctct
gctgaaggctccctgcacgcagcctgtgacccccggagtgggcagtgcagctgccggccc
cgtgtgacggggctgcggtgtgacacatgtgtgcccggtgcctacaacttcccctactgc
gaagctggctcttgccaccctgccggtctggccccagtggatcctgcccttcctgaggca
caggttccctgtatgtgccgggctcacgtggaggggccgagctgtgaccgctgcaaacct
gggttctggggactgagccccagcaaccccgagggctgtacccgctgcagctgcgacctc
aggggcacactgggtggagttgctgagtgccagccgggcaccggccagtgcttctgcaag
ccccacgtgtgcggccaggcctgcgcgtcctgcaaggatggcttctttggactggatcag
gctgactattttggctgccgcagctgccggtgtgacattggcggtgcactgggccagagc
tgtgaaccgaggacgggcgtctgccggtgccgccccaacacccagggccccacctgcagc
gagcctgcgagggaccactacctcccggacctgcaccacctgcgcctggagctggaggag
gctgccacacctgagggtcacgccgtgcgctttggcttcaaccccctcgagttcgagaac
ttcagctggaggggctacgcgcagatggcacctgtccagcccaggatcgtggccaggctg
aacctgacctcccctgaccttttctggctcgtcttccgatacgtcaaccggggggccatg
agtgtgagcgggcgggtctctgtgcgagaggagggcaggtcggccacctgcgccaactgc
acagcacagagtcagcccgtggccttcccacccagcacggagcctgccttcatcaccgtg
ccccagaggggcttcggagagccctttgtgctgaaccctggcacctgggccctgcgtgtg
gaggccgaaggggtgctcctggactacgtggttctgctgcctagcgcatactacgaggcg
gcgctcctgcagctgcgggtgactgaggcctgcacataccgtccctctgcccagcagtct
ggcgacaactgcctcctctacacacacctccccctggatggcttcccctcggccgccggg
ctggaggccctgtgtcgccaggacaacagcctgccccggccctgccccacggagcagctc
agcccgtcgcacccgccactgatcacctgcacgggcagtgatgtggacgtccagcttcaa
gtggcagtgccacagccaggccgctatgccctagtggtggagtacgccaatgaggatgcc
cgccaggaggtgggcgtggccgtgcacaccccacagcgggccccccagcaggggctgctc
tccctgcacccctgcctgtacagcaccctgtgccggggcactgcccgggatacccaggac
cacctggctgtcttccacctggactcggaggccagcgtgaggctcacagccgaacaggca
cgcttcttcctgcacggggtcactctggtgcccattgaggagttcagcccggagttcgtg
gagccccgggtcagctgcatcagcagccacggcgcctttggccccaacagtgccgcctgt
ctgccctcgcgcttcccaaagccgccccagcccatcatcctcagggactgccaggtgatc
ccgctgccgcccggcctcccgctgacccacgcgcaggatctcactccagccatgtcccca
gctggaccccgacctcggccccccaccgctgtggaccctgatgcagagcccaccctgctg
cgtgagccccaggccaccgtggtcttcaccacccatgtgcccacgctgggccgctatgcc
ttcctgctgcacggctaccagccagcccaccccaccttccccgtggaagtcctcatcaac
gccggccgcgtgtggcagggccacgccaacgccagcttctgtccacatggctacggctgc
cgcaccctggtggtgtgtgagggccaggccctgctggacgtgacccacagcgagctcact
gtgaccgtgcgtgtgcccaagggccggtggctctggctggattatgtactcgtggtccct
gagaacgtctacagctttggctacctccgggaggagcccctggataaatcctatgacttc
atcagccactgcgcagcccagggctaccacatcagccccagcagctcatccctgttctgc
cgaaacgctgctgcttccctctccctcttctataacaacggagcccgtccatgtggctgc
cacgaagtaggtgctacaggccccacgtgtgagcccttcgggggccagtgtccctgccat
gcccatgtcattggccgtgactgctcccgctgtgccaccggatactggggcttccccaac
tgcaggccctgtgactgcggtgcccgcctctgtgacgagctcacgggccagtgcatctgc
ccgccacgcaccatcccgcccgactgcctgctgtgccagccccagacctttggctgccac
cccctggtcggctgtgaggagtgtaactgctcagggcccggcatccaggagctcacagac
cctacctgtgacacagacagcggccagtgcaagtgcagacccaacgtgactgggcgccgc
tgtgatacctgctctccgggcttccatggctacccccgctgccgcccctgtgactgtcac
gaggcgggcactgcgcctggcgtgtgtgaccccctcacagggcagtgctactgtaaggag
aacgtgcagggccccaaatgtgaccagtgcagccttgggaccttctcactggatgctgcc
aaccccaaaggttgcacccgctgcttctgctttggggccacggagcgctgccggagctcg
tcctacacccgccaggagttcgtggatatggagggatgggtgctgctgagcactgaccgg
caggtggtgccccacgagcggcagccagggacggagatgctccgtgcagacctgcggcac
gtgcctgaggctgtgcccgaggctttccccgagctgtactggcaggccccaccctcctac
ctgggggaccgggtgtcatcctacggtgggaccctccgttatgaactgcactcagagacc
cagcggggagatgtctttgtccccatggagagcaggccggatgtggtgctgcagggcaac
cagatgagcatcacattcctggagccggcataccccacgcctggccacgttcaccgtggg
cagctgcagctggtggaggggaacttccggcatacggagacgcgcaacactgtgtcccgc
gaggagctcatgatggtgctggccagcctggagcagctgcagatccgtgccctcttctca
cagatctcctcggctgtcttcctgcgcagggtggcactggaggtggccagcccagcaggc
cagggggccctggccagcaatgtggagctgtgcctgtgccccgccagctaccggggggac
tcatgccaggaatgtgcccccggcttctatcgggacgtcaaaggtctcttcctgggccga
tgtgtcccttgtcagtgccatggacactcagaccgctgcctccctggctctggcgtctgt
gtggactgccagcacaacaccgaaggggcccactgtgagcgctgccaggctggcttcgtg
agcagcagggacgaccccagcgccccctgtgtcagctgcccctgccccctctcagtgcct
tccaacaacttcgccgagggctgtgtcctgcgaggcggccgcacccagtgcctctgcaaa
cctggttatgcaggtgcctcctgcgagcggtgtgcgcccggattctttgggaacccactg
gtgctgggcagctcctgccagccatgcgactgcagcggcaacggtgaccccaacttgctc
ttcagcgactgcgaccccctgacgggcgcctgccgtggctgcctgcgccacaccactggg
ccccgctgcgagatctgtgcccccggcttctacggcaacgccctgctgcccggcaactgc
acccggtgcgactgtaccccatgtgggacagaggcctgcgacccccacagcgggcactgc
ctgtgcaaggcgggcgtgactgggcggcgctgtgaccgctgccaggagggacattttggt
ttcgatggctgcgggggctgccgcccgtgtgcttgtggaccggccgccgagggctccgag
tgccacccccagagcggacagtgccactgccgaccagggaccatgggaccccagtgccgc
gagtgtgcccctggctactgggggctccctgagcagggctgcaggcgctgccagtgccct
gggggccgctgtgaccctcacacgggccgctgcaactgccccccggggctcagcggggag
cgctgcgacacctgcagccagcagcatcaggtgcctgttccaggcgggcctgtgggccac
agcatccactgtgaagtgtgtgaccactgtgtggtcctgctcctggatgacctggaacgg
gccggcgccctcctccccgccattcacgagcaactgcgtggcatcaatgccagctccatg
gcctgggcccgtctgcacaggctgaacgcctccatcgctgacctgcagagccagctccgg
agccccctgggcccccgccatgagacggcacagcagctggaggtgctggagcagcagagc
acaagcctcgggcaggacgcacggcggctaggcggccaggccgtggggacccgagaccag
gcgagccaattgctggccggcaccgaggccacactgggccatgcgaagacgctgttggcg
gccatccgggctgtggaccgcaccctgagcgagctcatgtcccagacgggccacctgggg
ctggccaatgcctcggctccatcaggtgagcagctgctccggacactggccgaggtggag
cggctgctctgggagatgcgggcccgggacctgggggccccgcaggcagcagctgaggct
gagttggctgcagcacagagattgctggcccgggtgcaggagcagctgagcagcctctgg
gaggagaaccaggcactggccacacaaacccgcgaccggctggcccagcacgaggccggc
ctcatggacctgcgagaggctttgaaccgggcagtggacgccacacgggaggcccaggag
ctcaacagccgcaaccaggagcgcctggaggaagccctgcaaaggaagcaggagctgtcc
cgggacaatgccaccctgcaggccactctgcatgcggctagggacaccctggccagcgtc
ttcagattgctgcacagcctggaccaggctaaggaggagctggagcgcctcgccgccagc
ctggacggggctcggaccccactgctgcagaggatgcagaccttctccccggcgggcagc
aagctgcgtctagtggaggccgccgaggcccacgcacagcagctgggccagctggcactc
aatctgtccagcatcatcctggacgtcaaccaggaccgcctcacccagagggccatcgag
gcctccaacgcctacagccgcatcctgcaggccgtgcaggctgccgaggatgctgctggc
caggccctgcagcaggcggaccacacgtgggcgacggtggtgcggcagggcctggtggac
cgagcccagcagctcctggccaacagcactgcactagaagaggccatgctccaggaacag
cagaggctgggccttgtgtgggctgccctccagggtgccaggacccagctccgagatgtc
cgggccaagaaggaccagctggaggcgcacatccaggcggcgcaggccatgcttgccatg
gacacagacgagacaagcaagaagatcgcacatgccaaggctgtggctgctgaagcccag
gacaccgccacccgtgtgcagtcccagctgcaggccatgcaggagaatgtggagcggtgg
cagggccagtacgagggcctgcggggccaggacctgggccaggcagtgcttgacgcaggc
cactcagtgtccaccctggagaagacgctgccccagctgctggccaagctgagcatcctg
gagaaccgtggggtgcacaacgccagcctggccctgtccgccagcattggccgcgtgcga
gagctcattgcccaggcccggggggctgccagtaaggtcaaggtgcccatgaagttcaac
gggcgctcaggggtgcagctgcgcaccccacgggatcttgccgaccttgctgcctacact
gccctcaagttctacctgcagggcccagagcctgagcctgggcagggtaccgaggatcgc
tttgtgatgtacatgggcagccgccaggccactggggactacatgggtgtgtctctgcgt
gacaagaaggtgcactgggtgtatcagctgggtgaggcgggccctgcagtcctaagcatc
gatgaggacattggggagcagttcgcagctgtcagcctggacaggactctccagtttggc
cacatgtccgtcacagtggagagacagatgatccaggaaaccaagggtgacacggtggcc
cctggggcagaggggctgctcaacctgcggccagacgacttcgtcttctacgtcgggggg
taccccagtaccttcacgccccctcccctgcttcgcttccccggctaccggggctgcatc
gagatggacacgctgaatgaggaggtggtcagcctctacaacttcgagaggaccttccag
ctggacacggctgtggacaggccttgtgcccgctccaagtcgaccggggacccgtggctc
acggacggctcctacctggacggcaccggcttcgcccgcatcagcttcgacagtcagatc
agcaccaccaagcgcttcgagcaggagctgcggctcgtgtcctacagcggggtgctcttc
ttcctgaagcagcagagccagttcctgtgcttggccgtgcaagaaggcagcctcgtgctg
ttgtatgactttggggctggcctgaaaaaggccgtcccactgcagcccccaccgcccctg
acctcggccagcaaggcgatccaggtgttcctgctggggggcagccgcaagcgtgtgctg
gtgcgtgtggagcgggccacggtgtacagcgtggagcaggacaatgatctggagctggcc
gacgcctactacctggggggcgtgccgcccgaccagctgcccccgagcctgcgacggctc
ttccccaccggaggctcagtccgtggctgcgtcaaaggcatcaaggccctgggcaagtat
gtggacctcaagcggctgaacacgacaggcgtgagcgccggctgcaccgccgacctgctg
gtggggcgcgccatgactttccatggccacggcttccttcgcctggcgctctcgaacgtg
gcaccgctcactggcaacgtctactccggcttcggcttccacagcgcccaggacagtgcc
ctgctctactaccgggcgtccccggatgggctatgccaggtgtccctgcagcagggccgt
gtgagcctacagctcctgaggactgaagtgaaaactcaagcgggcttcgccgatggtgcc
ccccattacgtcgccttctacagcaatgccacgggagtctggctgtatgtcgatgaccag
ctccagcagatgaagccccaccggggaccaccccccgagctccagccgcagcctgagggg
cccccgaggctcctcctgggaggcctgcctgagtctggcaccatttacaacttcagtggc
tgcatcagcaacgtcttcgtgcagcggctcctgggcccacagcgcgtatttgatctgcag
cagaacctgggcagcgtcaatgtgagcacgggctgtgcacccgccctgcaagcccagacc
ccgggcctggggcctagaggactgcaggccaccgcccggaaggcctcccgccgcagccgt
cagcccgcccggcatcctgcctgcatgctgcccccacacctcaggaccacccgagactcc
taccagtttgggggttccctgtccagtcacctggagtttgtgggcatcctggcccgacat
aggaactggcccagtctctccatgcacgtcctcccgcgaagctcccgaggcctcctcctc
ttcactgcccgtctgaggcccggcagcccctccctggcgctcttcctgagcaatggccac
ttcgttgcacagatggaaggcctcgggactcggctccgcgcccagagccgccagcgctcc
cggcctggccgctggcacaaggtctccgtgcgctgggagaagaaccggatcctgctggtg
acggacggggcccgggcctggagccaggaggggccgcaccggcagcaccagggggcagag
cacccccagccccacaccctctttgtgggcggcctcccggccagcagccacagctccaaa
cttccggtgaccgtcgggttcagcggctgtgtgaagagactgaggctgcacgggaggccc
ctgggggcccccacacggatggcaggggtcacaccctgcatcttgggccccctggaggcg
ggcctgttcttcccaggcagcgggggagttatcactttagacctcccaggagctacactg
cctgatgtgggcctggaactggaggtgcggcccctggcagtcaccggactgatcttccac
ttgggccaggcccggacgcccccctacttgcagttgcaggtgaccgagaagcaagtcctg
ctgcgggcggatgacggagcaggggagttctccacgtcagtgacccgcccctcagtgctg
tgtgatggccagtggcaccggctagcggtgatgaaaagcgggaatgtgctccggctggag
gtggacgcgcagagcaaccacaccgtgggccccttgctggcggctgcagctggtgcccca
gcccctctgtacctcgggggcctgcctgagcccatggccgtgcagccctggccccccgcc
tactgcggctgcatgaggaggctggcggtgaaccggtcccccgtcgccatgactcgctct
gtggaggtccacggggcagtgggggccagtggctgcccagccgcctag

DBGET integrated database retrieval system