KEGG   Homo sapiens (human): 391112Help
Entry
391112            CDS       T01001                                 

Gene name
OR6Y1, OR1-11, OR6Y2
Definition
(RefSeq) olfactory receptor family 6 subfamily Y member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    391112 (OR6Y1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    391112 (OR6Y1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    391112 (OR6Y1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 391112
NCBI-ProteinID: NP_001005189
HGNC: 14823
Ensembl: ENSG00000197532
Vega: OTTHUMG00000019629
Pharos: Q8NGX8(Tdark)
UniProt: Q8NGX8
Position
1q23.1
AA seq 325 aa AA seqDB search
MTTIILEVDNHTVTTRFILLGFPTRPAFQLLFFSIFLATYLLTLLENLLIILAIHSDGQL
HKPMYFFLSHLSFLEMWYVTVISPKMLVDFLSHDKSISFNGCMTQLYFFVTFVCTEYILL
AIMAFDRYVAICNPLRYPVIMTNQLCGTLAGGCWFCGLMTAMIKMVFIAQLHYCGMPQIN
HYFCDISPLLNVSCEDASQAEMVDFFLALMVIAIPLCVVVASYAAILATILRIPSAQGRQ
KAFSTCASHLTVVILFYSMTLFTYARPKLMYAYNSNKVVSVLYTVIVPLLNPIIYCLRNH
EVKAALRKTIHCRGSGPQGNGAFSS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccataattctggaagtagataatcatacagtgacaacacgtttcattcttctg
gggtttccaacacgaccagccttccagcttctctttttctccattttcctggcaacctat
ctgctgacactgctggagaatcttcttatcatcttagctatccacagtgatgggcagctg
cataagcccatgtacttcttcttgagccacctctccttcctggagatgtggtatgtcaca
gtcatcagccccaagatgcttgttgacttcctcagtcatgacaagagtatttccttcaat
ggctgcatgactcaactttacttttttgtgacctttgtctgcactgagtacatccttctt
gctatcatggcctttgaccgctatgtagccatttgtaatccactacgctacccagtcatc
atgaccaaccagctctgtggcacactggctggaggatgctggttctgtggactcatgact
gccatgattaagatggtttttatagcacaacttcactactgtggcatgcctcagatcaat
cactacttttgtgatatctctccactccttaacgtctcctgtgaggatgcctcacaggct
gagatggtggacttcttcttggccctcatggtcattgctattcctctttgtgttgtggtg
gcatcctacgctgctatccttgccaccatcctcaggatcccttctgctcagggccgccaa
aaggcattctccacctgtgcctcccacctgaccgtcgtaattctcttctattccatgaca
cttttcacctatgcccgtcccaaactcatgtatgcctacaattccaacaaagtggtatct
gttctctacactgtcattgttccactcctcaaccccatcatttactgtctgaggaaccat
gaagtaaaggcagccctcagaaagaccatacattgcagaggaagtgggccccagggaaat
ggggctttcagtagttaa

DBGET integrated database retrieval system