KEGG   Homo sapiens (human): 391123Help
Entry
391123            CDS       T01001                                 

Gene name
VSIG8
Definition
(RefSeq) V-set and immunoglobulin domain containing 8
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 391123
NCBI-ProteinID: NP_001013683
HGNC: 32063
Ensembl: ENSG00000243284
Vega: OTTHUMG00000168834
Pharos: Q5VU13(Tdark)
UniProt: P0DPA2
Position
1q23.2
AA seq 414 aa AA seqDB search
MRVGGAFHLLLVCLSPALLSAVRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDI
EWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSD
TATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKW
AKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCT
VANNVGYSVCVVEVKVSDSRRIGVIIGIVLGSLLALGCLAVGIWGLVCCCCGGSGAGGAR
GAFGYGNGGGVGGGACGDLASEIREDAVAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKY
APPPCGGPEDVALAPCTAAAACEAGPSPVYVKVKSAEPADCAEGPVQCKNGLLV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagagttggaggagcattccaccttctactcgtgtgcctgagcccagcactgctgtct
gctgtgcggatcaacggggatggacaggaggtcctgtacctggcagaaggtgataatgtg
aggctgggctgcccctacgtcctggaccctgaggactatggtcccaatgggctggacatc
gagtggatgcaggtcaactcagaccccgcccaccaccgagagaacgtgttccttagttac
caggacaagaggatcaaccatggcagccttccccatctgcagcagagggtccgctttgca
gcctcagacccaagccagtacgatgcctccatcaacctcatgaacctgcaggtatctgat
acagccacttatgagtgccgggtgaagaagaccaccatggccacccggaaggtcattgtc
actgtccaagcacgacctgcagtgcccatgtgctggacagagggccacatgacatatggc
aacgatgtggtgctgaagtgctatgccagtgggggctcccagcccctctcctacaagtgg
gccaagatcagtgggcaccattacccctatcgagctgggtcttacacctcccagcacagc
taccactcagagctgtcctaccaggagtccttccacagctccataaaccaaggcctgaac
aatggggacctggtgttgaaggatatctccagagcagatgatgggctgtatcagtgcaca
gtggccaacaacgtgggctacagtgtttgtgtggtggaggtgaaggtctcagactcccgg
cgtataggcgtgatcatcggcatcgtcctgggctctctgctcgcgctgggctgcctggcc
gtaggcatctgggggctcgtctgctgctgctgcgggggctccggggctggcggcgcccgc
ggtgccttcggctacggcaacggcggcggggtcggcggaggggcctgcggcgacttggct
agtgagatcagagaggacgccgtggcgcccgggtgcaaggccagcgggcgcggcagccgc
gtcacccacctcctggggtacccgacgcagaacgtcagccgctccctgcgccgcaagtac
gcgcctcccccctgcggcggccccgaggacgtggccctggcgccctgcaccgccgccgcc
gcctgcgaagcgggcccctccccggtctacgtcaaggtcaagagcgcggagccggctgac
tgcgccgaggggccggtgcagtgcaagaacggcctcttggtgtga

DBGET integrated database retrieval system