KEGG   Homo sapiens (human): 391189Help
Entry
391189            CDS       T01001                                 

Gene name
OR11L1
Definition
(RefSeq) olfactory receptor family 11 subfamily L member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    391189 (OR11L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    391189 (OR11L1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    391189 (OR11L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 391189
NCBI-ProteinID: NP_001001959
HGNC: 14998
Ensembl: ENSG00000197591
Vega: OTTHUMG00000040193
Pharos: Q8NGX0(Tdark)
UniProt: Q8NGX0
Position
1q44
AA seq 322 aa AA seqDB search
MEPQNTSTVTNFQLLGFQNLLEWQALLFVIFLLIYCLTIIGNVVIITVVSQGLRLHSPMY
MFLQHLSFLEVWYTSTTVPLLLANLLSWGQAISFSACMAQLYFFVFLGATECFLLAFMAY
DRYLAICSPLRYPFLMHRGLCARLVVVSWCTGVSTGFLPSLMISRLDFCGRNQINHFFCD
LPPLMQLSCSRVYITEVTIFILSIAVLCICFFLTLGPYVFIVSSILRIPSTSGRRKTFST
CGSHLAVVTLYYGTMISMYVCPSPHLLPEINKIISVFYTVVTPLLNPVIYSLRNKDFKEA
VRKVMRRKCGILWSTSKRKFLY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggagccccaaaatacctccactgtgactaactttcagctgttaggattccagaacctt
cttgaatggcaggccctgctctttgtcattttcctgctcatctactgcctgaccattata
gggaatgttgtcatcatcaccgtggtgagccagggcctgcgactgcactcccctatgtac
atgttcctccagcatctctcctttctggaggtctggtacacgtccaccactgtgcccctt
ctcctagccaacctgctgtcctggggccaagccatctccttctctgcctgcatggcacag
ctctacttcttcgtattcctcggcgccaccgagtgctttctcctggccttcatggcctat
gaccgttacctggccatctgcagcccactccgctaccccttcctcatgcatcgtgggctc
tgtgccaggttggtggtggtctcctggtgcacaggggtcagcacaggctttctgccttcc
ctgatgatttccaggttggacttctgtgggcgcaatcagattaaccatttcttctgcgac
ctcccgccactcatgcagctctcctgttccagagtttatatcaccgaggtgaccatcttc
atcctgtcaattgccgtgctgtgcatttgtttttttctgacactggggccctatgttttc
attgtgtcctccatattgagaatcccttccacctctggccggagaaagaccttttccaca
tgtggctcccacctggctgttgtcactctctactacgggaccatgatctccatgtatgtg
tgtcccagtccccacctgttgcctgaaatcaacaagatcatttctgtcttctacactgtg
gtcacaccactgctgaacccagttatctacagcttgaggaacaaagacttcaaagaagct
gttagaaaggtcatgagaaggaaatgtggtattctatggagtacaagtaaaaggaagttc
ctttattag

DBGET integrated database retrieval system