KEGG   Homo sapiens (human): 391190Help
Entry
391190            CDS       T01001                                 

Gene name
OR2L8
Definition
(RefSeq) olfactory receptor family 2 subfamily L member 8 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    391190 (OR2L8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    391190 (OR2L8)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    391190 (OR2L8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 391190
NCBI-ProteinID: NP_001001963
HGNC: 15014
Ensembl: ENSG00000279263
Vega: OTTHUMG00000040196
Pharos: Q8NGY9(Tdark)
UniProt: Q8NGY9
Position
1q44
AA seq 312 aa AA seqDB search
MENYNQTSTDFILLGLFPPSRIDLFFFILIVFIFLMALIGNLSMILLIFLDTHLHTPMYF
LLSQLSLIDLNYISTIVPKMASDFLHGNKSISFTGCGIQSFFFLALGGAEALLLASMAYD
RYIAICFPLHYLIRMSKRVCVLMITGSWIIGSINACAHTVYVLHIPYCRSRAINHFFCDV
PAMVTLACMDTWVYEGTVFLSATIFLVFPFIGISCSYGQVLFAVYHMKSAEGRKKAYLTC
STHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL
TRVSQRICSVKM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattacaatcaaacatcaactgatttcatcttattggggctgtttccaccatca
agaattgaccttttcttcttcattctcattgttttcattttcctgatggctctaattgga
aacctgtccatgattcttctcatcttcttggacacccatctccacacacccatgtatttc
ctactgagtcagctctccctcattgacctaaattacatctccaccattgttcctaagatg
gcatctgattttctgcatggaaacaagtctatctccttcactgggtgtgggattcagagt
ttcttcttcttggcattaggaggtgcagaagcactacttttggcatctatggcctatgat
cgttacattgctatttgctttcctctccactatctcatccgcatgagcaaaagagtgtgt
gtgctgatgataacagggtcttggatcataggctcgatcaatgcttgtgctcacactgta
tatgtactccatattccttattgccgatccagggccatcaatcatttcttctgtgatgtc
ccagcaatggtgactctggcctgcatggacacctgggtctatgagggcacagtgtttttg
agtgccaccatctttctcgtgtttcccttcattggtatttcatgttcctatggccaggtt
ctctttgctgtctaccacatgaaatctgcagaagggaggaagaaagcctatttgacctgc
agcacccacctcactgtagtaactttctactatgcaccttttgtctacacttatctacgt
ccaagatccctgcgatctccaacagaggacaaggttctggctgtcttctacaccatcctc
accccaatgctcaaccccatcatctatagcctgaggaacaaggaggtgatgggggccctg
acacgagtgagtcagagaatctgctctgtgaaaatgtag

DBGET integrated database retrieval system