KEGG   Homo sapiens (human): 391196
Entry
391196            CDS       T01001                                 

Gene name
OR2M7, OR1-58
Definition
(RefSeq) olfactory receptor family 2 subfamily M member 7
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    391196 (OR2M7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    391196 (OR2M7)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    391196 (OR2M7)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 391196
NCBI-ProteinID: NP_001004691
OMIM: 618509
HGNC: 19594
Ensembl: ENSG00000177186
Vega: OTTHUMG00000040461
Pharos: Q8NG81(Tdark)
UniProt: Q8NG81 A0A126GVZ1
Position
1q44
AA seq 312 aa
MAWENQTFNSDFLLLGIFNHSPTHTFLFFLVLAIFSVAFMGNSIMVLLIYLDTQLHTPMY
FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYISLLGSECFLLAVMSY
DRYTAICHPLRYTNLMRPKICGLMTAFSWILGSTDGIIDAVATFSFSYCGSREIAHFCCD
FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIITSYARVILAVIHMGSGEGRRKAFTT
CSSHLMVVGMYYGAGLFMCIQPTSHHSPMQDKMVSVFYTIVTPMLNPLIYSLRNKEVTRA
LMKILGKGKSGD
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcatgggagaatcagaccttcaactctgacttcctcctcctgggaatcttcaatcat
agccccacccacaccttcctcttctttctggtcctggccatcttttcagtggccttcatg
ggaaactccatcatggttctcctcatctacctggatacccagctccacacccccatgtac
ttcctcctcagccaactgtccctcatggacctcatgctcatctgcaccactgtacccaag
atggccttcaactacttgtctggcagcaagtccatttctatggctggctgtgccacacaa
attttcttctatatatcattgcttggctccgaatgctttctgttggctgttatgtcttat
gaccgctacactgccatttgccaccctctaagatacaccaatctcatgagacccaaaatt
tgtggacttatgactgccttctcctggatcctgggctctacagatggaatcattgatgct
gtagcgacattttccttctcctactgtgggtctcgggaaatagcccacttctgctgtgac
ttcccttccctactaatcctctcatgcaatgacacatcaatatttgaagaggttattttc
atctgctgtatagtaatgcttgttttccctgttgcaatcatcatcacttcctatgctcga
gttattctggctgtcattcacatgggatctggagagggacgtcgcaaagcttttactact
tgttcctctcacctcatggtggtgggaatgtactatggagcaggtttgttcatgtgcatt
cagcccacatctcatcattctcctatgcaggacaagatggtgtctgtattctacaccatc
gtcactcccatgctgaatcctctcatttatagcctccgcaacaaggaagtgaccagagca
ttaatgaaaatcttaggaaagggcaagtctggagattga

DBGET integrated database retrieval system