KEGG   Homo sapiens (human): 3912Help
Entry
3912              CDS       T01001                                 

Gene name
LAMB1, CLM, LIS5
Definition
(RefSeq) laminin subunit beta 1
  KO
K05636  laminin, beta 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Disease
H00268  Lissencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3912 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3912 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3912 (LAMB1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3912 (LAMB1)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    3912 (LAMB1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    3912 (LAMB1)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    3912 (LAMB1)
   05145 Toxoplasmosis
    3912 (LAMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 3912
NCBI-ProteinID: NP_002282
OMIM: 150240
HGNC: 6486
Ensembl: ENSG00000091136
Vega: OTTHUMG00000149966
Pharos: P07942(Tbio)
UniProt: P07942 Q8TAS6
Structure
PDB: 

Position
7q31.1
AA seq 1786 aa AA seqDB search
MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGG
VCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG
LIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQC
NEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGG
SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQC
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDA
LQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTG
CDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV
TEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNA
WQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEEL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
NT seq 5361 nt NT seq  +upstreamnt  +downstreamnt
atggggcttctccagttgctagctttcagtttcttagccctgtgcagagcccgagtgcgc
gctcaggaacccgagttcagctacggctgcgcagaaggcagctgctatcccgccacgggc
gaccttctcatcggccgagcacagaagctttcggtgacctcgacgtgcgggctgcacaag
cccgaaccctactgtatcgtcagccacttgcaggaggacaaaaaatgcttcatatgcaat
tcccaagatccttatcatgagaccctgaatcctgacagccatctcattgaaaatgtggtc
actacatttgctccaaaccgccttaagatttggtggcaatctgaaaatggtgtggaaaat
gtaactatccaactggatttggaagcagaattccattttactcatctcataatgactttc
aagacattccgtccagctgctatgctgatagaacgatcgtccgactttgggaaaacctgg
ggtgtgtatagatacttcgcctatgactgtgaggcctcgtttccaggcatttcaactggc
cccatgaaaaaagtcgatgacataatttgtgattctcgatattctgacattgaaccctca
actgaaggagaggtgatatttcgtgctttagatcctgctttcaaaatagaagatccttat
agcccaaggatacagaatttattaaaaattaccaacttgagaatcaagtttgtgaaactg
catactttgggagataaccttctggattccaggatggaaatcagagaaaagtattattat
gcagtttatgatatggtggttcgaggaaattgcttctgctatggtcatgccagcgaatgt
gcccctgtggatggattcaatgaagaagtggaaggaatggttcacggacactgcatgtgc
aggcataacaccaagggcttaaactgtgaactctgcatggatttctaccatgatttacct
tggagacctgctgaaggccgaaacagcaacgcctgtaaaaaatgtaactgcaatgaacat
tccatctcttgtcactttgacatggctgtttacctggccacggggaacgtcagcggaggc
gtgtgtgatgactgtcagcacaacaccatggggcgcaactgtgagcagtgcaagccgttt
tactaccagcacccagagagggacatccgagatcctaatttctgtgaacgatgtacgtgt
gacccagctggctctcaaaatgagggaatttgtgacagctatactgatttttctactggt
ctcattgctggccagtgtcggtgtaaattaaatgtggaaggagaacattgtgatgtttgc
aaagaaggcttctatgatttaagcagtgaagatccatttggttgtaaatcttgtgcttgc
aatcctctgggaacaattcctggagggaatccttgtgattccgagacaggtcactgctac
tgcaagcgtctggtgacaggacagcattgtgaccagtgcctgccagagcactggggctta
agcaatgatttggatggatgtcgaccatgtgactgtgaccttgggggagccttaaacaac
agttgctttgcggagtcaggccagtgctcatgccggcctcacatgattggacgtcagtgc
aacgaagtggaacctggttactactttgccaccctggatcactacctctatgaagcggag
gaagccaacttggggcctggggttagcatagtggagcggcaatatatccaggaccggatt
ccctcctggactggagccggcttcgtccgagtgcctgaaggggcttatttggagtttttc
attgacaacataccatattccatggagtacgacatcctaattcgctacgagccacagcta
cccgaccactgggaaaaagctgtcatcacagtgcagcgacctggaaggattccaaccagc
agccgatgtggtaataccatccccgatgatgacaaccaggtggtgtcattatcaccaggc
tcaagatatgtcgtccttcctcggccggtgtgctttgagaagggaacaaactacacggtg
aggttggagctgcctcagtacacctcctctgatagcgacgtggagagcccctacacgctg
atcgattctcttgttctcatgccatactgtaaatcactggacatcttcaccgtgggaggt
tcaggagatggggtggtcaccaacagtgcctgggaaacctttcagagataccgatgtcta
gagaacagcagaagcgttgtgaaaacaccgatgacagatgtttgcagaaacatcatcttt
agcatttctgccctgttacaccagacaggcctggcttgtgaatgcgaccctcagggttcg
ttaagttccgtgtgtgatcccaacggaggccagtgccagtgccggcccaacgtggttgga
agaacctgcaacagatgtgcacctggaacttttggctttggccccagtggatgcaaacct
tgtgagtgccatctgcaaggatctgtcaatgccttctgcaatcccgtcactggccagtgc
cactgtttccagggagtgtatgctcggcagtgtgatcggtgcttacctgggcactggggc
tttccaagttgccagccctgccagtgcaatggccacgccgatgactgcgacccagtgact
ggggagtgcttgaactgccaggactacaccatgggtcataactgtgaaaggtgcttggct
ggttactatggcgaccccatcattgggtcaggagatcactgccgcccttgcccttgccca
gatggtcccgacagtggacgccagtttgccaggagctgctaccaagatcctgttacttta
cagcttgcctgtgtttgtgatcctggatacattggttccagatgtgacgactgtgcctca
ggatactttggcaatccatcagaagttggggggtcgtgtcagccttgccagtgtcacaac
aacattgacacgacagacccagaagcctgtgacaaggagactgggaggtgtctcaagtgc
ctgtaccacacggaaggggaacactgtcagttctgccggtttggatactatggtgatgcc
ctccagcaggactgtcgaaagtgtgtctgtaattacctgggcaccgtgcaagagcactgt
aacggctctgactgccagtgcgacaaagccactggtcagtgcttgtgtcttcctaatgtg
atcgggcagaactgtgaccgctgtgcgcccaatacctggcagctggccagtggcactggc
tgtgacccatgcaactgcaatgctgctcattccttcgggccatcttgcaatgagttcacg
gggcagtgccagtgcatgcctgggtttggaggccgcacctgcagcgagtgccaggaactc
ttctggggagaccccgacgtggagtgccgagcctgtgactgtgaccccaggggcattgag
acgccacagtgtgaccagtccacgggccagtgtgtctgcgttgagggtgttgagggtcca
cgctgtgacaagtgcacgcgagggtactcgggggtcttccctgactgcacaccctgccac
cagtgctttgctctctgggatgtgatcattgccgagctgaccaacaggacacacagattc
ctggagaaagccaaggccttgaagatcagtggtgtgatcgggccttaccgtgagactgtg
gactcggtggagaggaaagtcagcgagataaaagacatcctggcgcagagccccgcagca
gagccactgaaaaacattgggaatctctttgaggaagcagagaaactgattaaagatgtt
acagaaatgatggctcaagtagaagtgaaattatctgacacaacttcccaaagcaacagc
acagccaaagaactggattctctacagacagaagccgaaagcctagacaacactgtgaaa
gaacttgctgaacaactggaatttatcaaaaactcagatattcggggtgccttggatagc
attaccaagtatttccagatgtctcttgaggcagaggagagggtgaatgcctccaccaca
gaacccaacagcactgtggagcagtcagccctcatgagagacagagtagaagacgtgatg
atggagcgagaatcccagttcaaggaaaaacaagaggagcaggctcgcctccttgatgaa
ctggcaggcaagctacaaagcctagacctttcagccgctgccgaaatgacctgtggaaca
cccccaggggcctcctgttccgagactgaatgtggcgggccaaactgcagaactgacgaa
ggagagaggaagtgtggggggcctggctgtggtggtctggttactgttgcacacaacgcc
tggcagaaagccatggacttggaccaagatgtcctgagtgccctggctgaagtggaacag
ctctccaagatggtctctgaagcaaaactgagggcagatgaggcaaaacaaagtgctgaa
gacattctgttgaagacaaatgctaccaaagaaaaaatggacaagagcaatgaggagctg
agaaatctaatcaagcaaatcagaaactttttgacccaggatagtgctgatttggacagc
attgaagcagttgctaatgaagtattgaaaatggagatgcctagcaccccacagcagtta
cagaacttgacagaagatatacgtgaacgagttgaaagcctttctcaagtagaggttatt
cttcagcatagtgctgctgacattgccagagctgagatgttgttagaagaagctaaaaga
gcaagcaaaagtgcaacagatgttaaagtcactgcagatatggtaaaggaagctctggaa
gaagcagaaaaggcccaggtcgcagcagagaaggcaattaaacaagcagatgaagacatt
caaggaacccagaacctgttaacttcgattgagtctgaaacagcagcttctgaggaaacc
ttgttcaacgcgtcccagcgcatcagcgagttagagaggaatgtggaagaacttaagcgg
aaagctgcccaaaactccggggaggcagaatatattgaaaaagtagtatatactgtgaag
caaagtgcagaagatgttaagaagactttagatggtgaacttgatgaaaagtataaaaaa
gtagaaaatttaattgccaaaaaaactgaagagtcagctgatgccagaaggaaagccgaa
atgctacaaaatgaagcaaaaactcttttagctcaagcaaatagcaagctgcaactgctc
aaagatttagaaagaaaatatgaagacaatcaaagatacttagaagataaagctcaagaa
ttagcaagactggaaggagaagtccgttcactcctaaaggatataagccagaaagttgct
gtgtatagcacatgcttgtaa

DBGET integrated database retrieval system