KEGG   Homo sapiens (human): 3913
Entry
3913              CDS       T01001                                 

Gene name
LAMB2, LAMS, NPHS5
Definition
(RefSeq) laminin subunit beta 2
  KO
K06243  laminin, beta 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Disease
H00576  Pierson syndrome
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3913 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3913 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3913 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3913 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3913 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3913 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3913 (LAMB2)
   05145 Toxoplasmosis
    3913 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C Sec5 DUF720
Other DBs
NCBI-GeneID: 3913
NCBI-ProteinID: NP_002283
OMIM: 150325
HGNC: 6487
Ensembl: ENSG00000172037
Vega: OTTHUMG00000156807
Pharos: P55268(Tbio)
UniProt: P55268
Position
3p21.31
AA seq 1798 aa
MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPK
DDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLIYNGA
LPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS
SLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHT
GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCA
PNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQC
HACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRV
VQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFN
SKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELQELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAETVQAALEEAQRAQGI
AQGAIRGAVADTRDTEQTLYQVQERMAGAERALSSAGERARQLDALLEALKLKRAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5397 nt   +upstreamnt  +downstreamnt
atggagctgacctcaagggaaagagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggctgccacactggcacaggcccctgccccggatgtgcct
ggctgttccaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacttgtggcctgaatggcccccagccctactgcatcgtcagt
cacctgcaggacgaaaagaagtgcttcctttgtgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaatgtagtcaccagctttgcaccacagcggcgg
gcagcctggtggcagtcagagaatggtatccctgcggtcaccatccagctggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcacccccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgctggaccctgccatccctatcccagacccctacagctcacggattcagaacctgttg
aagatcaccaacctacgggtgaacctgactcgtctacacacgttgggagacaacctactc
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctacggacacgcctcagagtgtgcacccgccccaggggcaccagcc
catgctgagggcatggtgcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgcgagcagtgtcaggatttctatcgtgacctgccctggcgtccggctgaggacggccat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gccgtatacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggac
ctgcgggatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggt
ggtcgctgtgattcccatgatgaccctgcactgggactggtctccggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccagcaatgccgtgatggcttctttgggctcagc
atcagtgaccgtctgggctgccggcgatgtcaatgtaatgcacggggcacagtgcctggg
agcactccttgtgaccccaacagtggatcctgttactgcaaacgtctagtgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgc
ccctgtgactgcgacgtgggtggtgctttggatccccagtgtgatgagggcacaggtcaa
tgccactgccgccagcacatggttgggcgacgctgtgagcaggtgcaacctggctacttc
cggcccttcctggaccacctaatttgggaggctgaggacacccgagggcaggtgctcgat
gtggtggagcgcctggtgacccccggggaaactccatcctggactggctcaggcttcgtg
cggctacaggaaggtcagaccctggagttcctggtggcctctgtgccgaaggctatggac
tatgacctgctgctgcgcttagagccccaggtccctgagcaatgggcagagttggaactg
attgtgcagcgtccagggcctgtgcctgcccacagcctgtgtgggcatttggtgcccaag
gatgatcgcatccaagggactctgcaaccacatgccaggtacttgatatttcctaatcct
gtctgccttgagcctggtatctcctacaagctgcatctgaagctggtacggacaggggga
agtgcccagcctgagactccctactctggacctggcctgctcattgactcgctggtgctg
ctgccccgtgtcctggtgctagagatgtttagtgggggtgatgctgctgccctggagcgc
caggccacctttgaacgctaccaatgccatgaggagggtctggtgcccagcaagacttct
ccctctgaggcctgcgcacccctcctcatcagcctgtccaccctcatctacaatggtgcc
ctgccatgtcagtgcaaccctcaaggttcactgagttctgagtgcaaccctcatggtggt
cagtgcctgtgcaagcctggagtggttgggcgccgctgtgacctctgtgcccctggctac
tatggctttggccccacaggctgtcaagcctgccagtgcagccacgagggggcactcagc
agtctctgtgaaaagaccagtgggcaatgtctctgtcgaactggtgcctttgggcttcgc
tgtgaccgctgccagcgtggccagtggggattccctagctgccggccatgtgtctgcaat
gggcatgcagatgagtgcaacacccacacaggcgcttgcctgggctgccgtgatcacaca
gggggtgagcactgtgaaaggtgcattgctggtttccacggggacccacggctgccatat
gggggccagtgccggccctgtccctgtcctgaaggccctgggagccaacggcactttgct
acttcttgccaccaggatgaatattcccagcagattgtgtgccactgccgggcaggctat
acggggctgcgatgtgaagcttgtgcccctgggcactttggggacccatcaaggccaggt
ggccggtgccaactgtgtgagtgcagtgggaacattgacccaatggatcctgatgcctgt
gacccccacacggggcaatgcctgcgctgtttacaccacacagagggtccacactgtgcc
cactgcaagcctggcttccatgggcaggctgcccgacagagctgtcaccgctgcacatgc
aacctgctgggcacaaatccgcagcagtgcccatctcctgaccagtgccactgtgatcca
agcagtgggcagtgcccatgcctccccaatgtccagggccctagctgtgaccgctgtgcc
cccaacttctggaacctcaccagtggccatggttgccagccttgtgcctgccacccaagc
cgggccagaggccccacctgcaacgagttcacagggcagtgccactgccgtgccggcttt
ggagggcggacttgttctgagtgccaagagctccactggggagaccctgggttgcagtgc
catgcctgtgattgtgactctcgtggaatagatacacctcagtgtcaccgcttcacaggt
cactgcagctgccgcccaggggtgtctggtgtgcgctgtgaccagtgtgcccgtggcttc
tcaggaatctttcctgcctgccatccctgccatgcatgcttcggggattgggaccgagtg
gtgcaggacttggcagcccgtacacagcgcctagagcagcgggcgcaggagttgcaacag
acgggtgtgctgggtgcctttgagagcagcttctggcacatgcaggagaagctgggcatt
gtgcagggcatcgtaggtgcccgcaacacctcagccgcctccactgcacagcttgtggag
gccacagaggagctgcggcgtgaaattggggaggccactgagcacctgactcagctcgag
gcagacctgacagatgtgcaagatgagaacttcaatgccaaccatgcactaagtggtctg
gagcgagataggcttgcacttaatctcacactgcggcagctcgaccagcatcttgacttg
ctcaaacattcaaacttcctgggtgcctatgacagcatccggcatgcccatagccagtct
gcagaggcagaacgtcgtgccaatacctcagccctggcagtacctagccctgtgagcaac
tcggcaagtgctcggcatcggacagaggcactgatggatgctcagaaggaggacttcaac
agcaaacacatggccaaccagcgggcacttggcaagctctctgcccatacccacaccctg
agcctgacagacataaatgagctggtgtgtggggcaccaggggatgcaccctgtgctaca
agcccttgtgggggtgccggctgtcgagatgaggatgggcagccgcgctgtgggggcctc
agctgcaatggggcagcggctacagcagacctagcactgggccgggcccggcacacacag
gcagagctgcagcgggcactggcagaaggtggtagcatcctcagcagagtggctgagact
cgtcggcaggcaagcgaggcacagcagcgggcccaggcagccctggacaaggctaatgct
tccaggggacaggtggaacaggccaaccaggaacttcaagaacttatccagagtgtgaag
gacttcctcaaccaggagggggctgatcctgatagcattgaaatggtggccacacgggtg
ctagagctctccatcccagcttcagctgagcagatccagcacctggcgggtgcgattgca
gagcgagtccggagcctggcagatgtggatgcgatcctggcacgtactgtaggagatgtg
cgtcgtgccgagcagctactgcaggatgcacggcgggcaaggagctgggctgaggatgag
aaacagaaggcagagacagtacaggcagcactggaggaggcccagcgggcacagggtatt
gcccagggtgccatccggggggcagtggctgacacacgggacacagagcagaccctgtac
caggtacaggagaggatggcaggtgcagagcgggcactgagctctgcaggtgaaagggct
cggcagttggatgctctcctggaggctctgaaattgaaacgggcaggaaatagtctggca
gcctctacagcagaagaaacggcaggcagtgcccagggtcgtgcccaggaggctgagcag
ctgctacgcggtcctctgggtgatcagtaccagacggtgaaggccctagctgagcgcaag
gcccaaggtgtgctggctgcacaggcaagggcagaacaactgcgggatgaggctcgggac
ctgttgcaagccgctcaggacaagctgcagcggctacaggaattggaaggcacctatgag
gaaaatgagcgggcactggagagtaaggcagcccagttggacgggttggaggccaggatg
cgcagcgtgcttcaagccatcaacttgcaggtgcagatctacaacacctgccagtga

DBGET integrated database retrieval system