KEGG   Homo sapiens (human): 3913Help
Entry
3913              CDS       T01001                                 

Gene name
LAMB2, LAMS, NPHS5
Definition
(RefSeq) laminin subunit beta 2
  KO
K06243  laminin, beta 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Disease
H00576  Pierson syndrome
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3913 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3913 (LAMB2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    3913 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3913 (LAMB2)
   05222 Small cell lung cancer
    3913 (LAMB2)
  Infectious diseases
   05165 Human papillomavirus infection
    3913 (LAMB2)
   05146 Amoebiasis
    3913 (LAMB2)
   05145 Toxoplasmosis
    3913 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N APG6 Sec5 F5_F8_type_C DUF720
Motif
Other DBs
NCBI-GeneID: 3913
NCBI-ProteinID: NP_002283
OMIM: 150325
HGNC: 6487
Ensembl: ENSG00000172037
Vega: OTTHUMG00000156807
Pharos: P55268(Tbio)
UniProt: P55268 A0A024R319
Position
3p21.31
AA seq 1798 aa AA seqDB search
MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPK
DDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLIYNGA
LPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS
SLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHT
GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCA
PNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQC
HACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRV
VQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFN
SKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELQELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAETVQAALEEAQRAQGI
AQGAIRGAVADTRDTEQTLYQVQERMAGAERALSSAGERARQLDALLEALKLKRAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5397 nt NT seq  +upstreamnt  +downstreamnt
atggagctgacctcaagggaaagagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggctgccacactggcacaggcccctgccccggatgtgcct
ggctgttccaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacttgtggcctgaatggcccccagccctactgcatcgtcagt
cacctgcaggacgaaaagaagtgcttcctttgtgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaatgtagtcaccagctttgcaccacagcggcgg
gcagcctggtggcagtcagagaatggtatccctgcggtcaccatccagctggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcacccccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgctggaccctgccatccctatcccagacccctacagctcacggattcagaacctgttg
aagatcaccaacctacgggtgaacctgactcgtctacacacgttgggagacaacctactc
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctacggacacgcctcagagtgtgcacccgccccaggggcaccagcc
catgctgagggcatggtgcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgcgagcagtgtcaggatttctatcgtgacctgccctggcgtccggctgaggacggccat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gccgtatacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggac
ctgcgggatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggt
ggtcgctgtgattcccatgatgaccctgcactgggactggtctccggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccagcaatgccgtgatggcttctttgggctcagc
atcagtgaccgtctgggctgccggcgatgtcaatgtaatgcacggggcacagtgcctggg
agcactccttgtgaccccaacagtggatcctgttactgcaaacgtctagtgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgc
ccctgtgactgcgacgtgggtggtgctttggatccccagtgtgatgagggcacaggtcaa
tgccactgccgccagcacatggttgggcgacgctgtgagcaggtgcaacctggctacttc
cggcccttcctggaccacctaatttgggaggctgaggacacccgagggcaggtgctcgat
gtggtggagcgcctggtgacccccggggaaactccatcctggactggctcaggcttcgtg
cggctacaggaaggtcagaccctggagttcctggtggcctctgtgccgaaggctatggac
tatgacctgctgctgcgcttagagccccaggtccctgagcaatgggcagagttggaactg
attgtgcagcgtccagggcctgtgcctgcccacagcctgtgtgggcatttggtgcccaag
gatgatcgcatccaagggactctgcaaccacatgccaggtacttgatatttcctaatcct
gtctgccttgagcctggtatctcctacaagctgcatctgaagctggtacggacaggggga
agtgcccagcctgagactccctactctggacctggcctgctcattgactcgctggtgctg
ctgccccgtgtcctggtgctagagatgtttagtgggggtgatgctgctgccctggagcgc
caggccacctttgaacgctaccaatgccatgaggagggtctggtgcccagcaagacttct
ccctctgaggcctgcgcacccctcctcatcagcctgtccaccctcatctacaatggtgcc
ctgccatgtcagtgcaaccctcaaggttcactgagttctgagtgcaaccctcatggtggt
cagtgcctgtgcaagcctggagtggttgggcgccgctgtgacctctgtgcccctggctac
tatggctttggccccacaggctgtcaagcctgccagtgcagccacgagggggcactcagc
agtctctgtgaaaagaccagtgggcaatgtctctgtcgaactggtgcctttgggcttcgc
tgtgaccgctgccagcgtggccagtggggattccctagctgccggccatgtgtctgcaat
gggcatgcagatgagtgcaacacccacacaggcgcttgcctgggctgccgtgatcacaca
gggggtgagcactgtgaaaggtgcattgctggtttccacggggacccacggctgccatat
gggggccagtgccggccctgtccctgtcctgaaggccctgggagccaacggcactttgct
acttcttgccaccaggatgaatattcccagcagattgtgtgccactgccgggcaggctat
acggggctgcgatgtgaagcttgtgcccctgggcactttggggacccatcaaggccaggt
ggccggtgccaactgtgtgagtgcagtgggaacattgacccaatggatcctgatgcctgt
gacccccacacggggcaatgcctgcgctgtttacaccacacagagggtccacactgtgcc
cactgcaagcctggcttccatgggcaggctgcccgacagagctgtcaccgctgcacatgc
aacctgctgggcacaaatccgcagcagtgcccatctcctgaccagtgccactgtgatcca
agcagtgggcagtgcccatgcctccccaatgtccagggccctagctgtgaccgctgtgcc
cccaacttctggaacctcaccagtggccatggttgccagccttgtgcctgccacccaagc
cgggccagaggccccacctgcaacgagttcacagggcagtgccactgccgtgccggcttt
ggagggcggacttgttctgagtgccaagagctccactggggagaccctgggttgcagtgc
catgcctgtgattgtgactctcgtggaatagatacacctcagtgtcaccgcttcacaggt
cactgcagctgccgcccaggggtgtctggtgtgcgctgtgaccagtgtgcccgtggcttc
tcaggaatctttcctgcctgccatccctgccatgcatgcttcggggattgggaccgagtg
gtgcaggacttggcagcccgtacacagcgcctagagcagcgggcgcaggagttgcaacag
acgggtgtgctgggtgcctttgagagcagcttctggcacatgcaggagaagctgggcatt
gtgcagggcatcgtaggtgcccgcaacacctcagccgcctccactgcacagcttgtggag
gccacagaggagctgcggcgtgaaattggggaggccactgagcacctgactcagctcgag
gcagacctgacagatgtgcaagatgagaacttcaatgccaaccatgcactaagtggtctg
gagcgagataggcttgcacttaatctcacactgcggcagctcgaccagcatcttgacttg
ctcaaacattcaaacttcctgggtgcctatgacagcatccggcatgcccatagccagtct
gcagaggcagaacgtcgtgccaatacctcagccctggcagtacctagccctgtgagcaac
tcggcaagtgctcggcatcggacagaggcactgatggatgctcagaaggaggacttcaac
agcaaacacatggccaaccagcgggcacttggcaagctctctgcccatacccacaccctg
agcctgacagacataaatgagctggtgtgtggggcaccaggggatgcaccctgtgctaca
agcccttgtgggggtgccggctgtcgagatgaggatgggcagccgcgctgtgggggcctc
agctgcaatggggcagcggctacagcagacctagcactgggccgggcccggcacacacag
gcagagctgcagcgggcactggcagaaggtggtagcatcctcagcagagtggctgagact
cgtcggcaggcaagcgaggcacagcagcgggcccaggcagccctggacaaggctaatgct
tccaggggacaggtggaacaggccaaccaggaacttcaagaacttatccagagtgtgaag
gacttcctcaaccaggagggggctgatcctgatagcattgaaatggtggccacacgggtg
ctagagctctccatcccagcttcagctgagcagatccagcacctggcgggtgcgattgca
gagcgagtccggagcctggcagatgtggatgcgatcctggcacgtactgtaggagatgtg
cgtcgtgccgagcagctactgcaggatgcacggcgggcaaggagctgggctgaggatgag
aaacagaaggcagagacagtacaggcagcactggaggaggcccagcgggcacagggtatt
gcccagggtgccatccggggggcagtggctgacacacgggacacagagcagaccctgtac
caggtacaggagaggatggcaggtgcagagcgggcactgagctctgcaggtgaaagggct
cggcagttggatgctctcctggaggctctgaaattgaaacgggcaggaaatagtctggca
gcctctacagcagaagaaacggcaggcagtgcccagggtcgtgcccaggaggctgagcag
ctgctacgcggtcctctgggtgatcagtaccagacggtgaaggccctagctgagcgcaag
gcccaaggtgtgctggctgcacaggcaagggcagaacaactgcgggatgaggctcgggac
ctgttgcaagccgctcaggacaagctgcagcggctacaggaattggaaggcacctatgag
gaaaatgagcgggcactggagagtaaggcagcccagttggacgggttggaggccaggatg
cgcagcgtgcttcaagccatcaacttgcaggtgcagatctacaacacctgccagtga

DBGET integrated database retrieval system