KEGG   Homo sapiens (human): 391365Help
Entry
391365            CDS       T01001                                 

Gene name
SULT6B1, ST6B1
Definition
(RefSeq) sulfotransferase family 6B member 1
  KO
K22523  sulfotransferase 6B1 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    391365 (SULT6B1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     391365 (SULT6B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 APS_kinase
Motif
Other DBs
NCBI-GeneID: 391365
NCBI-ProteinID: NP_001027549
OMIM: 617152
HGNC: 33433
Ensembl: ENSG00000138068
Vega: OTTHUMG00000152160
Pharos: Q6IMI4(Tdark)
UniProt: Q6IMI4 A0A0C4DG03
Position
2p22.2
AA seq 265 aa AA seqDB search
MCTSETFQALDTFEARHDDIVLASYPKCGSNWILHIVSELIYAVSKKKYKYPEFPVLECG
DSEKYQRMKGFPSPRILATHLHYDKLPGSIFENKAKILVIFRNPKDTAVSFLHFHNDVPD
IPSYGSWDEFFRQFMKGQVSWGRYFDFAINWNKHLDGDNVKFILYEDLKENLAAGIKQIA
EFLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNLFSEIQNQEM
DEKFKECLAGTSLGAKLKYESYCQG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtgcacctcagaaactttccaagcgctggacaccttcgaagccagacatgatgacatc
gtgctagcatcttatccaaagtgcggttcaaactggattctccacattgtcagtgaatta
atatatgctgtttctaaaaaaaagtataaatatccagaattcccagttcttgaatgtggg
gattcagaaaaatatcagagaatgaaaggctttccatcaccaaggattttggcaactcac
ctccactatgacaaattacctgggtctatcttcgagaataaagccaagatattggtgata
tttcgaaaccctaaagatacagcagtatcttttttgcatttccacaacgatgtccccgat
attccaagctatggctcttgggatgaattcttcagacagttcatgaaaggacaagtttct
tggggaaggtattttgattttgcaatcaattggaacaaacatcttgatggcgacaatgtt
aagttcatattatatgaagacctgaaagagaatctggctgctggaataaaacagattgct
gagttcttgggattctttctaactggggagcaaattcaaactatctcagtccagagcacc
ttccaagccatgcgtgcgaagtctcaggacacacacggtgctgtcggcccattccttttc
cgcaaaggtgaagttggtgattggaaaaatttgttcagtgaaattcagaaccaggaaatg
gatgaaaaattcaaagagtgcttagcaggcacctccctcggagcaaagttgaagtatgaa
tcatattgccagggttga

DBGET integrated database retrieval system