KEGG   Homo sapiens (human): 3918Help
Entry
3918              CDS       T01001                                 

Gene name
LAMC2, B2T, BM600, CSF, EBR2, EBR2A, LAMB2T, LAMNB2
Definition
(RefSeq) laminin subunit gamma 2
  KO
K06246  laminin, gamma 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Disease
H00586  Epidermolysis bullosa, junctional
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3918 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3918 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3918 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3918 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3918 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3918 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3918 (LAMC2)
   05145 Toxoplasmosis
    3918 (LAMC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_B
Motif
Other DBs
NCBI-GeneID: 3918
NCBI-ProteinID: NP_005553
OMIM: 150292
HGNC: 6493
Ensembl: ENSG00000058085
Vega: OTTHUMG00000035520
Pharos: Q13753(Tbio)
UniProt: Q13753
Position
1q25.3
AA seq 1193 aa AA seqDB search
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDRELHRQTGNGFRCLNCNDNT
DGIHCEKCKNGFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDGGN
PEGCTQCFCYGHSASCRSSAEYSVHKITSTFHQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSAQRLDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTFRLNEHPSNNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSDGTCVCKPGFGGP
NCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGVVPDTELEGRMQQAEQAL
QDILRDAQISEGASRSLGLQLAKVRSQENSYQSRLDDLKMTVERVRALGSQYQNRVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTR
ETEDYSKQALSLVRKALHEGVGSGSGSPDGAVVQGLVEKLEKTKSLAQQLTREATQAEIE
ADRSYQHSLRLLDSVSRLQGVSDQSFQVEEAKRIKQKADSLSSLVTRHMDEFKRTQKNLG
NWKEEAQQLLQNGKSGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDASDKTQQAERALGSAAADAQRAKNGAGEALEISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKSEMREVEGELERKELEFDTNMDAVQMVITE
AQKVDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRP
MMSELEERARQQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgctctggctgggctgctgcctctgcttctcgctcctcctgcccgcagcccgg
gccacctccaggagggaagtctgtgattgcaatgggaagtccaggcagtgtatctttgat
cgggaacttcacagacaaactggtaatggattccgctgcctcaactgcaatgacaacact
gatggcattcactgcgagaagtgcaagaatggcttttaccggcacagagaaagggaccgc
tgtttgccctgcaattgtaactccaaaggttctcttagtgctcgatgtgacaactccgga
cggtgcagctgtaaaccaggtgtgacaggagccagatgcgaccgatgtctgccaggcttc
cacatgctcacggatgcggggtgcacccaagaccagagactgctagactccaagtgtgac
tgtgacccagctggcatcgcagggccctgtgacgcgggccgctgtgtctgcaagccagct
gtcactggagaacgctgtgataggtgtcgatcaggttactataatctggatggggggaac
cctgagggctgtacccagtgtttctgctatgggcattcagccagctgccgcagctctgca
gaatacagtgtccataagatcacctctacctttcatcaagatgttgatggctggaaggct
gtccaacgaaatgggtctcctgcaaagctccaatggtcacagcgccatcaagatgtgttt
agctcagcccaacgactagaccctgtctattttgtggctcctgccaaatttcttgggaat
caacaggtgagctatggtcaaagcctgtcctttgactaccgtgtggacagaggaggcaga
cacccatctgcccatgatgtgattctggaaggtgctggtctacggatcacagctcccttg
atgccacttggcaagacactgccttgtgggctcaccaagacttacacattcaggttaaat
gagcatccaagcaataattggagcccccagctgagttactttgagtatcgaaggttactg
cggaatctcacagccctccgcatccgagctacatatggagaatacagtactgggtacatt
gacaatgtgaccctgatttcagcccgccctgtctctggagccccagcaccctgggttgaa
cagtgtatatgtcctgttgggtacaaggggcaattctgccaggattgtgcttctggctac
aagagagattcagcgagactggggccttttggcacctgtattccttgtaactgtcaaggg
ggaggggcctgtgatccagacacaggagattgttattcaggggatgagaatcctgacatt
gagtgtgctgactgcccaattggtttctacaacgatccgcacgacccccgcagctgcaag
ccatgtccctgtcataacgggttcagctgctcagtgatgccggagacggaggaggtggtg
tgcaataactgccctcccggggtcaccggtgcccgctgtgagctctgtgctgatggctac
tttggggacccctttggtgaacatggcccagtgaggccttgtcagccctgtcaatgcaac
aacaatgtggaccccagtgcctctgggaattgtgaccggctgacaggcaggtgtttgaag
tgtatccacaacacagccggcatctactgcgaccagtgcaaagcaggctacttcggggac
ccattggctcccaacccagcagacaagtgtcgagcttgcaactgtaaccccatgggctca
gagcctgtaggatgtcgaagtgatggcacctgtgtttgcaagccaggatttggtggcccc
aactgtgagcatggagcattcagctgtccagcttgctataatcaagtgaagattcagatg
gatcagtttatgcagcagcttcagagaatggaggccctgatttcaaaggctcagggtggt
gatggagtagtacctgatacagagctggaaggcaggatgcagcaggctgagcaggccctt
caggacattctgagagatgcccagatttcagaaggtgctagcagatcccttggtctccag
ttggccaaggtgaggagccaagagaacagctaccagagccgcctggatgacctcaagatg
actgtggaaagagttcgggctctgggaagtcagtaccagaaccgagttcgggatactcac
aggctcatcactcagatgcagctgagcctggcagaaagtgaagcttccttgggaaacact
aacattcctgcctcagaccactacgtggggccaaatggctttaaaagtctggctcaggag
gccacaagattagcagaaagccacgttgagtcagccagtaacatggagcaactgacaagg
gaaactgaggactattccaaacaagccctctcactggtgcgcaaggccctgcatgaagga
gtcggaagcggaagcggtagcccggacggtgctgtggtgcaagggcttgtggaaaaattg
gagaaaaccaagtccctggcccagcagttgacaagggaggccactcaagcggaaattgaa
gcagataggtcttatcagcacagtctccgcctcctggattcagtgtctcggcttcaggga
gtcagtgatcagtcctttcaggtggaagaagcaaagaggatcaaacaaaaagcggattca
ctctcaagcctggtaaccaggcatatggatgagttcaagcgtacacagaagaatctggga
aactggaaagaagaagcacagcagctcttacagaatggaaaaagtgggagagagaaatca
gatcagctgctttcccgtgccaatcttgctaaaagcagagcacaagaagcactgagtatg
ggcaatgccactttttatgaagttgagagcatccttaaaaacctcagagagtttgacctg
caggtggacaacagaaaagcagaagctgaagaagccatgaagagactctcctacatcagc
cagaaggtttcagatgccagtgacaagacccagcaagcagaaagagccctggggagcgct
gctgctgatgcacagagggcaaagaatggggccggggaggccctggaaatctccagtgag
attgaacaggagattgggagtctgaacttggaagccaatgtgacagcagatggagccttg
gccatggaaaagggactggcctctctgaagagtgagatgagggaagtggaaggagagctg
gaaaggaaggagctggagtttgacacgaatatggatgcagtacagatggtgattacagaa
gcccagaaggttgataccagagccaagaacgctggggttacaatccaagacacactcaac
acattagacggcctcctgcatctgatggaccagcctctcagtgtagatgaagaggggctg
gtcttactggagcagaagctttcccgagccaagacccagatcaacagccaactgcggccc
atgatgtcagagctggaagagagggcacgtcagcagaggggccacctccatttgctggag
acaagcatagatgggattctggctgatgtgaagaacttggagaacattagggacaacctg
cccccaggctgctacaatacccaggctcttgagcaacagtga

DBGET integrated database retrieval system