KEGG   Homo sapiens (human): 392197
Entry
392197            CDS       T01001                                 

Gene name
USP17L7
Definition
(RefSeq) ubiquitin specific peptidase 17 like family member 7
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UCH UCH_1 HABP4_PAI-RBP1
Other DBs
NCBI-GeneID: 392197
NCBI-ProteinID: NP_001243798
HGNC: 37180
Ensembl: ENSG00000226430
Vega: OTTHUMG00000165294
Pharos: P0C7H9(Tdark)
UniProt: P0C7H9
Position
8p23.1
AA seq 530 aa
MEDDSLYLGGDWQFNHFSKLTSSRLDAAFAEIQRTSLSEKSPLSSETRFDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQKIGNTFYVNVSLQCLTYTLPLSNYMLSREDSQTCHLH
KCCMFCTMQAHITWALHSPGHVIQPSQVLAAGFHRGEQEDAHEFLMFTVDAMKKACLPGH
KQLDHHSKDTTLIHQIFGAYWRSQIKYLHCHGVSDTFDPYLDIALDIQAAQSVKQALEQL
VKPKELNGENAYHCGLCLQKAPASKTLTLPTSAKVLILVLKRFSDVTGNKLAKNVQYPKC
RDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASGIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRPATQGELKRDHPCLQVPEL
DEHLVERATQESTLDHWKFPQEQNKTKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHP
EQQSSLLNLSSTKPTDQESMNTGTLASLQGSTRRSKGNNKHSKRSLLVCQ
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggaagacgactcactctatttgggaggtgactggcagttcaatcacttttcaaaactc
acatcttctcggctagatgcagcttttgctgaaatccagcggacttctctctctgaaaag
tcaccactctcatctgagacccgtttcgacctctgtgatgatttggctcctgtggcaaga
cagcttgctcccagggagaagcttcctctgagtagcaggagacctgctgcggtgggggct
gggctccagaagataggaaataccttctatgtgaacgtttccctgcagtgcctgacatac
acactgccgctttccaactacatgctgtcccgggaggactctcaaacgtgtcatcttcac
aagtgctgcatgttctgtactatgcaagctcacatcacatgggccctccacagtcctggc
catgtcatccagccctcacaggtattggctgctggcttccatagaggtgagcaggaggat
gcccatgaatttctcatgtttactgtggatgccatgaaaaaggcatgccttcccgggcac
aagcagctagatcatcactccaaggacaccaccctcatccaccaaatatttggagcgtat
tggagatctcaaatcaagtatctccactgccacggcgtttcagacacctttgacccttac
ctggacatcgccctggatatccaggcagctcagagtgtcaagcaagctttggaacagttg
gtgaagcccaaagaactcaatggagagaatgcctatcattgtggtctttgtctccagaag
gcgcctgcctccaagacgttaactttacccacttctgccaaggtcctcattcttgtattg
aagagattctccgatgtcacaggcaacaaacttgccaagaatgtgcaatatcctaagtgc
cgtgacatgcagccatacatgtctcagcagaacacaggacctcttgtctatgtcctctat
gctgtgctggtccacgctgggtggagttgtcacaacggacattacttctcttatgtcaaa
gctcaagaaggccagtggtataaaatggatgatgccgaggtcactgcctctggcatcacc
tctgtcctgagtcaacaggcctatgtcctcttttacatccagaagagtgaatgggaaaga
cacagtgagagtgtgtcaagaggcagggaaccaagagcccttggtgctgaagacacagac
aggccagcaacgcaaggagagctcaagagagaccacccttgcctccaggtacccgagttg
gacgagcacttggtggaaagagccactcaggaaagcaccttagaccactggaaattcccc
caagagcaaaacaaaacgaagcctgagttcaacgtcagaaaagttgaaggtaccctgcct
cccaacgtacttgtgattcatcaatcaaaatacaagtgtggtatgaaaaaccatcatcct
gaacagcaaagctccctgctaaacctctcttcgacgaaaccgacagatcaggagtccatg
aacactggcacactcgcttctctgcaagggagcaccaggagatccaaagggaataacaaa
cacagcaagagatctctgcttgtgtgccagtga

DBGET integrated database retrieval system