KEGG   Homo sapiens (human): 392399
Entry
392399            CDS       T01001                                 

Gene name
LCN9, HEL129
Definition
(RefSeq) lipocalin 9
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Lipocalin DUF4941 UDPGP
Other DBs
NCBI-GeneID: 392399
NCBI-ProteinID: NP_001001676
OMIM: 612903
HGNC: 17442
Ensembl: ENSG00000148386
Vega: OTTHUMG00000020916
Pharos: Q8WX39(Tdark)
UniProt: Q8WX39 V9HWI8
Position
9q34.3
AA seq 176 aa
MALLLLSLGLSLIAAQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFV
RNIEHLKNGSLIFDFEYMVQGECVAVVVVCEKTEKNGEYSINYEGQNTVAVSETDYRLFI
TFHLQNFRNGTETHTLALYETCEKYGLGSQNIIDLTNKDPCYSKHYRSPPRPPMRW
NT seq 531 nt   +upstreamnt  +downstreamnt
atggctctgcttctgctgagcctggggctgagcctcatcgcagcccaggagttcgatccc
cacaccgttatgcagaggaactacaacgtggccagggtttcaggggtctggtattctatt
ttcatggcctcagatgacctgaatcggattaaagaaaatggagacctgagggtcttcgtc
cggaatattgaacacttgaagaacggcagcctaatatttgatttcgaatacatggtgcag
ggggagtgtgtggctgtggtcgtggtctgcgagaagacagagaagaatggggaatactcc
atcaactatgagggccagaacacagtggccgtctcggagactgactacaggctgttcatc
accttccacctccagaacttcaggaacgggaccgagacccacacgctggcgctctatgaa
acctgcgaaaagtacggacttggctcacaaaatatcatcgacttgaccaacaaagatccc
tgctactccaagcattacaggagcccgcccaggcctcccatgcggtggtaa

DBGET integrated database retrieval system