KEGG   Homo sapiens (human): 392490Help
Entry
392490            CDS       T01001                                 

Gene name
FLJ44635
Definition
(RefSeq) TPT1-like protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TCTP
Motif
Other DBs
NCBI-GeneID: 392490
NCBI-ProteinID: NP_997305
Ensembl: ENSG00000204131
UniProt: Q56UQ5
Position
Xq13.1
AA seq 140 aa AA seqDB search
METVIMIIYWDLISHSEMFSDSYMSQEIADGLRLEVEGKIVSRTEGNIFDSLIGGNASAE
GPEGKGTESTVITGVDSVMNHHLQETSFTKEAYNKCIKDYMKSIKGKLEEQRPKRVKPFM
TGAAEQIKHILANFKNYQKT
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccgtcatcatgattatctactgggacctcatcagccacagtgagatgttctct
gacagttacatgagccaggaaattgcagacgggctgcgcctggaggtggaagggaagata
gtcagtaggacagaaggtaacatttttgactcgctcattggtggaaatgcctccgctgaa
ggccctgagggcaaaggtaccgaaagcacagtaatcactggtgtcgatagtgtcatgaat
catcacctgcaagaaacaagcttcacaaaagaagcctacaataagtgcatcaaagattac
atgaaatcaatcaaaggcaaactggaagaacagagaccaaaaagagtaaaaccttttatg
acaggagctgcagaacagatcaagcacatccttgctaatttcaaaaactaccagaaaaca
tga

DBGET integrated database retrieval system