KEGG   Homo sapiens (human): 3925Help
Entry
3925              CDS       T01001                                 

Gene name
STMN1, C1orf215, LAP18, Lag, OP18, PP17, PP19, PR22, SMN
Definition
(RefSeq) stathmin 1
  KO
K04381  stathmin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3925 (STMN1)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    3925 (STMN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3925 (STMN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Stathmin
     3925 (STMN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin Ribonuc_2-5A Exonuc_VII_L zf-CRD WTX
Motif
Other DBs
NCBI-GeneID: 3925
NCBI-ProteinID: NP_005554
OMIM: 151442
HGNC: 6510
Ensembl: ENSG00000117632
Vega: OTTHUMG00000007389
Pharos: P16949(Tbio)
UniProt: P16949
Position
1p36.11
AA seq 149 aa AA seqDB search
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHIEEVRKNKESKDPADETEAD
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctgatatccaggtgaaagaactggagaagcgtgcctcaggccaggctttt
gagctgattctcagccctcggtcaaaagaatctgttccagaattccccctttcccctcca
aagaagaaggatctttccctggaggaaattcagaagaaattagaagctgcagaagaaaga
cgcaagtcccatgaagctgaggtcttgaagcagctggctgagaaacgagagcacgagaaa
gaagtgcttcagaaggcaatagaagagaacaacaacttcagtaaaatggcagaagagaaa
ctgacccacaaaatggaagctaataaagagaaccgagaggcacaaatggctgccaaactg
gaacgtttgcgagagaaggataagcacattgaagaagtgcggaagaacaaagaatccaaa
gaccctgctgacgagactgaagctgactaa

DBGET integrated database retrieval system