KEGG   Homo sapiens (human): 392636Help
Entry
392636            CDS       T01001                                 

Gene name
AGMO, TMEM195
Definition
(RefSeq) alkylglycerol monooxygenase
  KO
K15537  alkylglycerol monooxygenase [EC:1.14.16.5]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    392636 (AGMO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.5  alkylglycerol monooxygenase
     392636 (AGMO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_hydroxylase
Motif
Other DBs
NCBI-GeneID: 392636
NCBI-ProteinID: NP_001004320
OMIM: 613738
HGNC: 33784
Ensembl: ENSG00000187546
Vega: OTTHUMG00000152387
Pharos: Q6ZNB7(Tbio)
UniProt: Q6ZNB7 X5D773
Position
7p21.2
AA seq 445 aa AA seqDB search
MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWI
LKGKPPGRLDDALTSISAGVLSRLPSLFFRSIELTSYIYIWENYRLFNLPWDSPWTWYSA
FLGVDFGYYWFHRMAHEVNIMWAGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALF
IPPSVYAVHLQFNLLYQFWIHTEVINNLGPLELILNTPSHHRVHHGRNRYCIDKNYAGVL
IIWDKIFGTFEAENEKVVYGLTHPINTFEPIKVQFHHLFSIWTTFWATPGFFNKFSVIFK
GPGWGPGKPRLGLSEEIPEVTGKEVPFSSSSSQLLKIYTVVQFALMLAFYEETFADTAAL
SQVTLLLRVCFIILTLTSIGFLLDQRPKAAIMETLRCLMFLMLYRFGHLKPLVPSLSSAF
EIVFSICIAFWGVRSMKQLTSHPWK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacccagaagcccagcaggatgtttcagtttcccagggatttcgcatgttgttt
tacacgatgaaacccagtgaaacttcattccaaacattagaagaggtgcctgattatgta
aaaaaggcaactccatttttcatttctttgatgctgcttgaacttgttgtcagctggatt
ctcaaaggaaagccaccaggtcgcctggatgatgctttaacgtcaatctcagctggtgtt
ctgtctcgacttccaagtctatttttcaggagcattgaactgaccagttatatttatatc
tgggagaactacaggctgttcaatttgccttgggattctccatggacttggtattcagcc
ttcttaggagttgactttggctactactggttccatcgtatggctcatgaagttaatatt
atgtgggccggacaccaaacacatcatagttctgaagactataacttatccacagcactg
agacagtctgtcctccagatatatacttcctggattttctactctcccctggccctcttc
atacccccttcagtatatgctgttcatcttcaattcaatcttctttaccaattttggatc
catacagaggtcatcaataaccttggtcctttggaactgattcttaatactcctagccat
catagggttcatcatggcagaaatcgttattgcatagacaaaaattatgctggtgttctt
attatttgggataaaatttttgggacatttgaagcagaaaatgaaaaagttgtatatggc
ttaacacatcccattaatacatttgaaccaatcaaagtgcagttccatcacttattttcc
atatggactacattctgggccacacctggattcttcaataagttttctgtcatatttaag
ggaccgggatggggtccaggtaaaccaagacttggtctcagtgaagaaattccagaggtc
accggcaaagaagttcccttctcatcatcttcatctcagctattaaagatatatacagtt
gtacagtttgctctgatgttggcattttatgaagagacctttgcagatacagctgcactg
tcgcaagttactctccttctgagggtttgcttcattatcctgaccttgacttccattgga
tttcttctggatcaaagacccaaggcagctattatggaaactctccgttgcttgatgttc
ttaatgctgtaccgatttggtcacctgaagcctcttgtcccttcattgtcatctgctttt
gagattgttttttccatttgcattgctttctggggagttagaagcatgaaacaactcacc
tctcacccttggaaataa

DBGET integrated database retrieval system