KEGG   Homo sapiens (human): 3929
Entry
3929              CDS       T01001                                 

Symbol
LBP, BPIFD2
Name
(RefSeq) lipopolysaccharide binding protein
  KO
K05399  lipopolysaccharide-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3929 (LBP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3929 (LBP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3929 (LBP)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3929 (LBP)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3929 (LBP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3929 (LBP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3929 (LBP)
SSDB
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP PHA_gran_rgn
Other DBs
NCBI-GeneID: 3929
NCBI-ProteinID: NP_004130
OMIM: 151990
HGNC: 6517
Ensembl: ENSG00000129988
Vega: OTTHUMG00000032447
Pharos: P18428(Tbio)
UniProt: P18428 Q8TCF0
Position
20q11.23
AA seq 481 aa
MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLP
DFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRK
SFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNL
FHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEAPRATA
QMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLN
FSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDP
YMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN
AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMR
V
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgggggccttggccagagccctgccgtccatactgctggcattgctgcttacgtccacc
ccagaggctctgggtgccaaccccggcttggtcgccaggatcaccgacaagggactgcag
tatgcggcccaggaggggctattagctctgcagagtgagctgctcaggatcacgctgcct
gacttcaccggggacttgaggatcccccacgtcggccgtgggcgctatgagttccacagc
ctgaacatccacagctgtgagctgcttcactctgcgctgaggcctgtccctggccagggc
ctgagtctcagcatctccgactcctccatccgggtccagggcaggtggaaggtgcgcaag
tcattcttcaaactacagggctcctttgatgtcagtgtcaagggcatcagcatttcggtc
aacctcctgttgggcagcgagtcctccgggaggcccacagttactgcctccagctgcagc
agtgacatcgctgacgtggaggtggacatgtcgggagacttggggtggctgttgaacctc
ttccacaaccagattgagtccaagttccagaaagtactggagagcaggatttgcgaaatg
atccagaaatcagtgtcctccgatctacagccttatctccaaactctgccagttacaaca
gagattgacagtttcgccgacattgattatagcttagtggaagcccctcgggcaacagcc
cagatgctggaggtgatgtttaagggtgaaatctttcatcgtaaccaccgttctccagtt
accctccttgctgcagtcatgagccttcctgaggaacacaacaaaatggtctactttgcc
atctcggattatgtcttcaacacggccagcctggtttatcatgaggaaggatatctgaac
ttctccatcacagatgacatgataccgcctgactctaatatccgactgaccaccaagtcc
ttccgacccttcgtcccacggttagccaggctctaccccaacatgaacctggaactccag
ggatcagtgccctctgctccgctcctgaacttcagccctgggaatctgtctgtggacccc
tatatggagatagatgcctttgtgctcctgcccagctccagcaaggagcctgtcttccgg
ctcagtgtggccactaatgtgtccgccaccttgaccttcaataccagcaagatcactggg
ttcctgaagccaggaaaggtaaaagtggaactgaaagaatccaaagttggactattcaat
gcagagctgttggaagcgctcctcaactattacatccttaacaccttctaccccaagttc
aatgataagttggccgaaggcttcccccttcctctgctgaagcgtgttcagctctacgac
cttgggctgcagatccataaggacttcctgttcttgggtgccaatgtccaatacatgaga
gtttga

DBGET integrated database retrieval system