KEGG   Homo sapiens (human): 3937Help
Entry
3937              CDS       T01001                                 

Gene name
LCP2, SLP-76, SLP76
Definition
(RefSeq) lymphocyte cytosolic protein 2
  KO
K07361  lymphocyte cytosolic protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04380  Osteoclast differentiation
hsa04611  Platelet activation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3937 (LCP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    3937 (LCP2)
   04650 Natural killer cell mediated cytotoxicity
    3937 (LCP2)
   04660 T cell receptor signaling pathway
    3937 (LCP2)
   04664 Fc epsilon RI signaling pathway
    3937 (LCP2)
  09158 Development
   04380 Osteoclast differentiation
    3937 (LCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SAM_2 SDA1 SAM_1
Motif
Other DBs
NCBI-GeneID: 3937
NCBI-ProteinID: NP_005556
OMIM: 601603
HGNC: 6529
Ensembl: ENSG00000043462
Vega: OTTHUMG00000163121
Pharos: Q13094(Tbio)
UniProt: Q13094
Structure
PDB: 

Position
5q35.1
AA seq 533 aa AA seqDB search
MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ
DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSG
KTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK
PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPL
PGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHM
PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES
QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaggaatgtgccctttcgctcagaggtcctgggctgggaccccgacagcctt
gctgactatttcaagaagctcaactataaggactgtgagaaggcagtgaagaagtaccac
atcgatggggctcgcttcttgaacctgacagaaaatgacatccagaagttccccaagctc
cgggtgccgattctcagtaagttaagtcaggaaatcaacaagaacgaagagaggaggagc
atcttcacacgcaaaccccaagtcccgcggtttcctgaagagacagaaagccacgaagag
gacaatgggggctggtcgtcctttgaagaagacgattatgaaagtcccaatgatgaccag
gatggggaggatgatggagactatgagtcccccaatgaggaggaagaggcacccgtggaa
gatgacgcggattatgagccgccaccctccaatgacgaggaagctctgcagaactccatc
ctgcctgccaagcctttccccaactccaactccatgtacatcgaccggcccccctctggg
aaaaccccccagcagcctcctgtgcccccccagagaccgatggccgccctcccgccccca
ccagccggccggaatcactcgccactgcccccaccccagaccaaccacgaagaacccagc
agaagcagaaaccacaaaacggcaaagctccctgctccttcaatagacagaagcacgaaa
cctcccctagatcgttcattagctccgtttgatagagaacccttcacactaggaaagaaa
ccaccattttctgacaagccctcgattccagcgggaaggtcactcggggagcatttaccc
aagattcaaaagcctcctttaccaccgaccacggaaagacatgaaaggagcagccccctg
ccagggaagaagccacctgtgccaaagcatggatggggaccagacagaagagagaatgat
gaagatgatgtgcatcagagacctttgccccagccagcactacttcctatgagctccaac
actttcccttcaagatctactaagccaagtcccatgaaccctctcccatcctctcacatg
cctggagcattctcagaaagtaacagcagttttccacagagtgcctccctgccaccatac
ttctctcaaggccctagcaacagaccacctatcagagccgaaggcagaaacttccccttg
ccacttccaaacaaacctcggcccccatcccccgcggaggaagagaattcattaaatgaa
gagtggtacgtttcttatattacccgaccagaggcagaagctgctcttagaaagataaac
caggatggcacatttctggtcagagacagctctaaaaaaacaacaaccaatccatatgtc
ctcatggtgttgtacaaagataaagtttacaacatccagatccgttatcagaaggaaagt
caagtttacttgttgggaactggactccgagggaaagaggactttctgtctgtgtcagat
attattgactacttcaggaaaatgccacttctgctcattgatgggaaaaaccgaggttcc
agataccagtgcacattaacgcatgctgcagggtacccatag

DBGET integrated database retrieval system