KEGG   Homo sapiens (human): 394263Help
Entry
394263            CDS       T01001                                 

Gene name
MUC21, C6orf205, KMQK697, MUC-21
Definition
(RefSeq) mucin 21, cell surface associated
  KO
K22022  mucin-21
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    394263 (MUC21)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Membrane bound mucins
    394263 (MUC21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epiglycanin_TR Epiglycanin_C
Motif
Other DBs
NCBI-GeneID: 394263
NCBI-ProteinID: NP_001010909
OMIM: 616991
HGNC: 21661
Ensembl: ENSG00000204544
Vega: OTTHUMG00000031216
Pharos: Q5SSG8(Tdark)
UniProt: Q5SSG8
Position
6p21.33
AA seq 566 aa AA seqDB search
MKMQKGNVLLMFGLLLHLEAATNSNETSTSANTGSSVISSGASTATNSGSSVTSSGVSTA
TISGSSVTSNGVSIVTNSEFHTTSSGISTATNSEFSTVSSGISIATNSESSTTSSGASTA
TNSESSTPSSGASTATNSDSSTTSSGASTATNSDSSTTSSEASTATNSESSTTSSGASTA
TNSESSTVSSRASTATNSESSTTSSGASTATNSESRTTSNGAGTATNSESSTTSSGASTA
TNSESSTPSSGAGTATNSESSTTSSGAGTATNSESSTVSSGISTVTNSESSTPSSGANTA
TNSESSTTSSGANTATNSDSSTTSSGASTATNSESSTTSSGASTATNSESSTTSSGASTA
TNSGSSTTSSGTSTATNSESSTVSSGASTATTSESSTTSSGASTATNSESSTVSSGASTA
TNSESSTTSSGANTATNSGSSVTSAGSGTAALTGMHTTSHSASTAVSEAKPGGSLVPWEI
FLITLVSVVAAVGLFAGLFFCVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRP
RWSPNWFWRRPVSSIAMEMSGRNSGP
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcagaaaggaaatgttctccttatgtttggtctactattgcatttagaagct
gcaacaaattccaatgagactagcacctctgccaacactggatccagtgtgatctccagt
ggagccagcacagccaccaactctgggtccagtgtgacctccagtggggtcagcacagcc
accatctcagggtccagcgtgacctccaatggggtcagcatagtcaccaactctgagttc
catacaacctccagtgggatcagcacagccaccaactctgagttcagcacagtgtccagt
gggatcagcatagccaccaactctgagtccagcacaacctccagtggggccagcacagcc
accaactctgagtccagcacaccctccagtggggccagcacagccaccaactctgactcc
agcacaacctccagtggggctagcacagccaccaactctgactccagcacaacctccagt
gaggccagcacagccaccaactctgagtccagcacaacctccagtggggccagcacagcc
accaactctgagtccagcacagtgtccagtagggccagcactgccaccaactctgagtcc
agcacaacctccagtggggccagcacagccaccaactctgagtccagaacgacctccaat
ggggctggcacagccaccaactctgagtccagcacgacctccagtggggccagcacagcc
accaactctgagtccagcacaccctccagtggggccggcacagccaccaactctgagtcc
agcacgacctccagtggggccggcacagccaccaactctgagtccagcacagtgtccagt
gggatcagcacagtcaccaattctgagtccagcacaccctccagtggggccaacacagcc
accaactctgagtccagtacgacctccagtggggccaacacagccaccaactctgactcc
agcacaacctccagtggggccagcacagccaccaactctgagtccagcacgacctccagt
ggggccagcacagccaccaactctgagtccagcacaacctccagtggggccagcacagcc
accaactctgggtccagcacgacctccagtgggaccagcacagccaccaactctgagtcc
agcacagtgtccagtggggccagcacagccaccacctctgagtccagcacgacctccagt
ggggccagcacagccaccaactctgagtccagcacagtgtccagtggggccagcactgcc
accaattctgagtccagcacaacctccagtggggccaacacagccaccaactctgggtcc
agtgtgacctctgcaggctctggaacagcagctctgactggaatgcacacaacttcccat
agtgcatctactgcagtgagtgaggcgaagcctggtgggtccctggtgccgtgggaaatc
ttcctcatcaccctggtctcggttgtggcggccgtggggctctttgctgggctcttcttc
tgtgtgagaaacagcctgtccctgagaaacacctttaacacagctgtctaccaccctcat
ggcctcaaccatggccttggtccaggccctggagggaatcatggagccccccacaggccc
aggtggagtcctaactggttctggaggagaccagtatcctcgatagccatggagatgagc
gggaggaacagcgggccctga

DBGET integrated database retrieval system