KEGG   Homo sapiens (human): 3952Help
Entry
3952              CDS       T01001                                 

Gene name
LEP, LEPD, OB, OBS
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04152  AMPK signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Disease
H02059  Leptin deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3952 (LEP)
   04152 AMPK signaling pathway
    3952 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3952 (LEP)
   04060 Cytokine-cytokine receptor interaction
    3952 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    3952 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3952 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3952 (LEP)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   3952 (LEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Leptin
Motif
Other DBs
NCBI-GeneID: 3952
NCBI-ProteinID: NP_000221
OMIM: 164160
HGNC: 6553
Ensembl: ENSG00000174697
Vega: OTTHUMG00000157564
Pharos: P41159(Tbio)
UniProt: P41159 A4D0Y8
Structure
PDB: 

Position
7q32.1
AA seq 167 aa AA seqDB search
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcattggggaaccctgtgcggattcttgtggctttggccctatcttttctatgtccaa
gctgtgcccatccaaaaagtccaagatgacaccaaaaccctcatcaagacaattgtcacc
aggatcaatgacatttcacacacgcagtcagtctcctccaaacagaaagtcaccggtttg
gacttcattcctgggctccaccccatcctgaccttatccaagatggaccagacactggca
gtctaccaacagatcctcaccagtatgccttccagaaacgtgatccaaatatccaacgac
ctggagaacctccgggatcttcttcacgtgctggccttctctaagagctgccacttgccc
tgggccagtggcctggagaccttggacagcctggggggtgtcctggaagcttcaggctac
tccacagaggtggtggccctgagcaggctgcaggggtctctgcaggacatgctgtggcag
ctggacctcagccctgggtgctga

DBGET integrated database retrieval system