KEGG   Homo sapiens (human): 3955Help
Entry
3955              CDS       T01001                                 

Gene name
LFNG, SCDO3
Definition
(RefSeq) LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
Disease
H00517  Spondylocostal dysostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    3955 (LFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3955 (LFNG)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    3955 (LFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    3955 (LFNG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     3955 (LFNG)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   3955 (LFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T Fur_reg_FbpA
Motif
Other DBs
NCBI-GeneID: 3955
NCBI-ProteinID: NP_001035257
OMIM: 602576
HGNC: 6560
Ensembl: ENSG00000106003
Vega: OTTHUMG00000152043
Pharos: Q8NES3(Tbio)
UniProt: Q8NES3
Position
7p22.3
AA seq 379 aa AA seqDB search
MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAA
AAAPGALVRDVHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVK
TTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCK
MAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERV
SENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVEAL
LGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFR
SIHCHLYPDTPWCPRTAIF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgctgcggccggcgcctgctgctggcgctggcgggcgcgctgctcgcctgc
ctgctggtgctcaccgccgacccgccgccgcctccactgcccgccgagcgcggccggcgc
gcgctgcgcagcctggcgggccccgcgggggctgccccggcgcccgggctgggggcggcg
gcggcggcgcccggggcgctggtccgcgacgtgcacagtctgtccgagtacttcagcctg
ctcacccgcgcgcgcagagatgcgggcccgccgcccggggctgccccccgccccgccgac
ggccacccgcgccccctggccgagccgctcgcgccccgagacgtcttcatcgctgtcaag
accaccaaaaagttccaccgcgcgcgcctcgacctgctgctggagacctggatctcgcgc
cacaaggagatgacgttcatcttcactgacggggaagatgaggccctggccaggcacacg
ggcaacgtggtcatcacaaactgctcggccgcccacagccgccaggcgctgtcctgcaag
atggccgtggagtatgaccgcttcatcgagtccggcaggaagtggttctgccacgtggac
gatgacaactacgtcaacctgcgggccctgctgcggctgctggccagctacccgcacacg
cgggacgtctacgtcggcaagcccagcctggacaggcccatccaggccatggagcgggtc
agcgagaacaaggtgcgtcctgtccacttctggtttgccacgggcggcgctggcttctgc
atcagccgtgggctggctctgaagatgagcccgtgggccagcgggggtcacttcatgaat
acggctgagcggatccggctgcctgatgactgcaccatcggctacatcgtggaggccctg
ctgggtgtgcccctcatccgcagcggcctcttccactcccacctggagaacctgcagcag
gtgcccacctcggagctccacgagcaggtgacgctgagctacggtatgtttgaaaacaag
cggaacgccgtccacgtgaaggggcccttctcggtggaggccgacccatccaggttccgc
tccatccactgccacctgtacccggacacaccctggtgtccccgcactgccatcttctag

DBGET integrated database retrieval system