KEGG   Homo sapiens (human): 3955
Entry
3955              CDS       T01001                                 
Symbol
LFNG, SCDO3
Name
(RefSeq) LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
Network
nt06511  NOTCH signaling
  Element
N01480  Notch-HES7 signaling
N01481  Notch-MESP2 signaling
Disease
H00517  Spondylocostal dysostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    3955 (LFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3955 (LFNG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3955 (LFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    3955 (LFNG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     3955 (LFNG)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   3955 (LFNG)
SSDB
Motif
Pfam: Fringe Galactosyl_T Fur_reg_FbpA
Other DBs
NCBI-GeneID: 3955
NCBI-ProteinID: NP_001035257
OMIM: 602576
HGNC: 6560
Ensembl: ENSG00000106003
Pharos: Q8NES3(Tbio)
UniProt: Q8NES3
Position
7:2512529..2529177
AA seq 379 aa
MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAA
AAAPGALVRDVHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVK
TTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCK
MAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERV
SENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVEAL
LGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFR
SIHCHLYPDTPWCPRTAIF
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgctcaagcgctgcggccggcgcctgctgctggcgctggcgggcgcgctgctcgcctgc
ctgctggtgctcaccgccgacccgccgccgcctccactgcccgccgagcgcggccggcgc
gcgctgcgcagcctggcgggccccgcgggggctgccccggcgcccgggctgggggcggcg
gcggcggcgcccggggcgctggtccgcgacgtgcacagtctgtccgagtacttcagcctg
ctcacccgcgcgcgcagagatgcgggcccgccgcccggggctgccccccgccccgccgac
ggccacccgcgccccctggccgagccgctcgcgccccgagacgtcttcatcgctgtcaag
accaccaaaaagttccaccgcgcgcgcctcgacctgctgctggagacctggatctcgcgc
cacaaggagatgacgttcatcttcactgacggggaagatgaggccctggccaggcacacg
ggcaacgtggtcatcacaaactgctcggccgcccacagccgccaggcgctgtcctgcaag
atggccgtggagtatgaccgcttcatcgagtccggcaggaagtggttctgccacgtggac
gatgacaactacgtcaacctgcgggccctgctgcggctgctggccagctacccgcacacg
cgggacgtctacgtcggcaagcccagcctggacaggcccatccaggccatggagcgggtc
agcgagaacaaggtgcgtcctgtccacttctggtttgccacgggcggcgctggcttctgc
atcagccgtgggctggctctgaagatgagcccgtgggccagcgggggtcacttcatgaat
acggctgagcggatccggctgcctgatgactgcaccatcggctacatcgtggaggccctg
ctgggtgtgcccctcatccgcagcggcctcttccactcccacctggagaacctgcagcag
gtgcccacctcggagctccacgagcaggtgacgctgagctacggtatgtttgaaaacaag
cggaacgccgtccacgtgaaggggcccttctcggtggaggccgacccatccaggttccgc
tccatccactgccacctgtacccggacacaccctggtgtccccgcactgccatcttctag

KEGG   Homo sapiens (human): 4242
Entry
4242              CDS       T01001                                 
Symbol
MFNG
Name
(RefSeq) MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06511  NOTCH signaling
  Element
N00381  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    4242 (MFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    4242 (MFNG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    4242 (MFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    4242 (MFNG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     4242 (MFNG)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   4242 (MFNG)
SSDB
Motif
Pfam: Fringe Galactosyl_T
Other DBs
NCBI-GeneID: 4242
NCBI-ProteinID: NP_002396
OMIM: 602577
HGNC: 7038
Ensembl: ENSG00000100060
Pharos: O00587(Tbio)
UniProt: O00587
Position
22:complement(37469063..37486384)
AA seq 321 aa
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAV
KTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALS
CKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASE
PQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIE
CKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
FRSLHCLLYPDTPWCPQLGAR
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcagtgccggctcccgcggggcctggctggagccctcctcaccctcctgtgcatgggg
ctcctgtgtctgcggtaccacttgaacctgtccccgcagcgggtacaagggacccccgag
ctgagccagccgaacccggggccccctaagctacagctacacgatgtcttcattgcagtg
aagacgacccgggctttccaccgcttgcgcctggagctgctgcttgacacgtgggtttcc
aggaccagggaacagacatttgtcttcaccgacagcccagacaaaggcctccaggagaga
ctggggtcccaccttgtggtcaccaactgctccgcggaacacagccacccagctctgtcc
tgcaagatggctgctgagttcgacaccttcttggccagtgggcttaggtggttctgccat
gtggacgatgacaactatgtgaacccaagggcgctgctgcagcttctgagagccttcccg
ctggcccgcgacgtctatgtgggaaggcccagcctgaaccggcccatccatgcctcagag
ccacagccccacaaccgcacgaggctggtacagttctggtttgccactgggggtgctggc
ttctgcatcaatcgcaaactggctttgaagatggctccgtgggccagtggctcccgtttc
atggacacatctgctctcatccggctgcctgatgactgcaccatgggctatatcattgag
tgcaagctgggcggccgcctgcagcccagccccctctttcactcccacctggagaccctg
cagctgctgaggactgcacagctcccagaacaggtcaccctcagctacggtgtctttgag
gggaaactcaacgtcattaagctacagggccccttctccccggaggaggacccctccaga
tttcgctccctccattgtctgctctatccagatacaccctggtgtccccagctgggtgcc
cgatga

KEGG   Homo sapiens (human): 5986
Entry
5986              CDS       T01001                                 
Symbol
RFNG
Name
(RefSeq) RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    5986 (RFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    5986 (RFNG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5986 (RFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    5986 (RFNG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     5986 (RFNG)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   5986 (RFNG)
SSDB
Motif
Pfam: Fringe
Other DBs
NCBI-GeneID: 5986
NCBI-ProteinID: NP_002908
OMIM: 602578
HGNC: 9974
Ensembl: ENSG00000169733
Pharos: Q9Y644(Tdark)
UniProt: Q9Y644 Q8N9R1
Position
17:complement(82047902..82051811)
AA seq 331 aa
MSRARGALCRACLALAAALAALLLLPLPLPRAPAPARTPAPAPRAPPSRPAAPSLRPDDV
FIAVKTTRKNHGPRLRLLLRTWISRARQQTFIFTDGDDPELELQGGDRVINTNCSAVRTR
QALCCKMSVEYDKFIESGRKWFCHVDDDNYVNARSLLHLLSSFSPSQDVYLGRPSLDHPI
EATERVQGGRTVTTVKFWFATGGAGFCLSRGLALKMSPWASLGSFMSTAEQVRLPDDCTV
GYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPHNVVNVAGGFSLH
QDPTRFKSIHCLLYPDTDWCPRQKQGAPTSR
NT seq 996 nt   +upstreamnt  +downstreamnt
atgagccgcgcgcgtggggcgctgtgccgggcctgcctcgcgctggccgcggccctggcc
gcgctgctgttactgccgctgccgctgccccgcgcgcccgccccggcccggacccccgcc
ccggccccgcgcgcgcccccgtcccggcccgctgcccccagcctgcggcctgacgacgtc
ttcatcgccgtcaagaccacccggaagaaccacgggccgcgcctgcggctgctgctgcgc
acctggatctcccgggcccgccagcagacgtttatcttcaccgacggggacgaccctgag
ctcgagctccagggcggcgaccgtgtcatcaacaccaactgctcggcggtgcgcactcgt
caggccctctgctgcaagatgtccgtggagtatgacaagttcattgagtccgggcgcaag
tggttttgccacgtggatgatgacaattatgtgaacgccaggagcctcctgcacctgctc
tccagcttctcacccagccaggacgtctacctggggcggcccagcctggaccaccccatt
gaggccaccgagagggtccagggtggcagaactgtgaccacggtcaagttctggtttgct
actggtggggccgggttctgcctcagcagaggccttgccctcaagatgagcccatgggcc
agcctgggcagcttcatgagcacagctgagcaggtgcggctgccggatgactgcacagtt
ggctacatcgtggaggggctcctgggcgcccgcctgctgcacagccccctcttccactct
cacctggagaacctgcagaggctgccgcccgacaccctgctccagcaggttaccttgagc
catgggggtcctgagaacccacataacgtggtgaacgtggctggaggcttcagcctgcat
caagaccccacacggtttaagtctatccattgtcttctgtacccagacacggactggtgt
cccaggcagaaacagggcgccccgacctctcggtga

DBGET integrated database retrieval system