KEGG   Homo sapiens (human): 3956Help
Entry
3956              CDS       T01001                                 

Gene name
LGALS1, GAL1, GBP
Definition
(RefSeq) galectin 1
  KO
K06830  galectin-1
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   3956 (LGALS1)
Lectins [BR:hsa04091]
 S-type lectins (Galectins)
  3956 (LGALS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin DUF1344
Motif
Other DBs
NCBI-GeneID: 3956
NCBI-ProteinID: NP_002296
OMIM: 150570
HGNC: 6561
Ensembl: ENSG00000100097
Vega: OTTHUMG00000150661
Pharos: P09382(Tchem)
UniProt: P09382
Structure
PDB: 

Position
22q13.1
AA seq 135 aa AA seqDB search
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtggtctggtcgccagcaacctgaatctcaaacctggagagtgccttcgagtg
cgaggcgaggtggctcctgacgctaagagcttcgtgctgaacctgggcaaagacagcaac
aacctgtgcctgcacttcaaccctcgcttcaacgcccacggcgacgccaacaccatcgtg
tgcaacagcaaggacggcggggcctgggggaccgagcagcgggaggctgtctttcccttc
cagcctggaagtgttgcagaggtgtgcatcaccttcgaccaggccaacctgaccgtcaag
ctgccagatggatacgaattcaagttccccaaccgcctcaacctggaggccatcaactac
atggcagctgacggtgacttcaagatcaaatgtgtggcctttgactga

DBGET integrated database retrieval system