KEGG   Homo sapiens (human): 3958Help
Entry
3958              CDS       T01001                                 

Gene name
LGALS3, CBP35, GAL3, GALBP, GALIG, L31, LGALS2, MAC2
Definition
(RefSeq) galectin 3
  KO
K06831  galectin-3
Organism
hsa  Homo sapiens (human)
Drug target
Belapectin: D11495
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3958 (LGALS3)
   04091 Lectins [BR:hsa04091]
    3958 (LGALS3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   3958 (LGALS3)
Lectins [BR:hsa04091]
 S-type lectins (Galectins)
  3958 (LGALS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin
Motif
Other DBs
NCBI-GeneID: 3958
NCBI-ProteinID: NP_002297
OMIM: 153619
HGNC: 6563
Ensembl: ENSG00000131981
Vega: OTTHUMG00000171030
Pharos: P17931(Tchem)
UniProt: P17931 A0A024R693
Structure
PDB: 

Position
14q22.3
AA seq 250 aa AA seqDB search
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
DLTSASYTMI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaatttttcgctccatgatgcgttatctgggtctggaaacccaaaccctcaa
ggatggcctggcgcatgggggaaccagcctgctggggcagggggctacccaggggcttcc
tatcctggggcctaccccgggcaggcacccccaggggcttatcctggacaggcacctcca
ggcgcctaccctggagcacctggagcttatcccggagcacctgcacctggagtctaccca
gggccacccagcggccctggggcctacccatcttctggacagccaagtgccaccggagcc
taccctgccactggcccctatggcgcccctgctgggccactgattgtgccttataacctg
cctttgcctgggggagtggtgcctcgcatgctgataacaattctgggcacggtgaagccc
aatgcaaacagaattgctttagatttccaaagagggaatgatgttgccttccactttaac
ccacgcttcaatgagaacaacaggagagtcattgtttgcaatacaaagctggataataac
tggggaagggaagaaagacagtcggttttcccatttgaaagtgggaaaccattcaaaata
caagtactggttgaacctgaccacttcaaggttgcagtgaatgatgctcacttgttgcag
tacaatcatcgggttaaaaaactcaatgaaatcagcaaactgggaatttctggtgacata
gacctcaccagtgcttcatataccatgatataa

DBGET integrated database retrieval system