KEGG   Homo sapiens (human): 3959Help
Entry
3959              CDS       T01001                                 

Gene name
LGALS3BP, 90K, BTBD17B, CyCAP, M2BP, MAC-2-BP, TANGO10B, gp90
Definition
(RefSeq) galectin 3 binding protein
  KO
K17300  galectin-3-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3959 (LGALS3BP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3959 (LGALS3BP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRCR BACK SRCR_2 Hepsin-SRCR
Motif
Other DBs
NCBI-GeneID: 3959
NCBI-ProteinID: NP_005558
OMIM: 600626
HGNC: 6564
Ensembl: ENSG00000108679
Vega: OTTHUMG00000177572
Pharos: Q08380(Tbio)
UniProt: Q08380 A0A0S2Z3Y1
Structure
PDB: 

Position
17q25.3
AA seq 585 aa AA seqDB search
MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV
VCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAG
VVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANL
EAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQ
GYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP
TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPMMLPEELFELQ
FNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTD
SSWSARKSQLVYQSRRGPLVKYSSDYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSL
VYLPTIQSCWNYGFSCSSDELPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGW
KAAIPSALDTNSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgacccctccgaggctcttctgggtgtggctgctggttgcaggaacccaaggcgtgaac
gatggtgacatgcggctggccgatgggggcgccaccaaccagggccgcgtggagatcttc
tacagaggccagtggggcactgtgtgtgacaacctgtgggacctgactgatgccagcgtc
gtctgccgggccctgggcttcgagaacgccacccaggctctgggcagagctgccttcggg
caaggatcaggccccatcatgctggatgaggtccagtgcacgggaaccgaggcctcactg
gccgactgcaagtccctgggctggctgaagagcaactgcaggcacgagagagacgctggt
gtggtctgcaccaatgaaaccaggagcacccacaccctggacctctccagggagctctcg
gaggcccttggccagatctttgacagccagcggggctgcgacctgtccatcagcgtgaat
gtgcagggcgaggacgccctgggcttctgtggccacacggtcatcctgactgccaacctg
gaggcccaggccctgtggaaggagccgggcagcaatgtcaccatgagtgtggatgctgag
tgtgtgcccatggtcagggaccttctcaggtacttctactcccgaaggattgacatcacc
ctgtcgtcagtcaagtgcttccacaagctggcctctgcctatggggccaggcagctgcag
ggctactgcgcaagcctctttgccatcctcctcccccaggacccctcgttccagatgccc
ctggacctgtatgcctatgcagtggccacaggggacgccctgctggagaagctctgccta
cagttcctggcctggaacttcgaggccttgacgcaggccgaggcctggcccagtgtcccc
acagacctgctccaactgctgctgcccaggagcgacctggcggtgcccagcgagctggcc
ctactgaaggccgtggacacctggagctggggggagcgtgcctcccatgaggaggtggag
ggcttggtggagaagatccgcttccccatgatgctccctgaggagctctttgagctgcag
ttcaacctgtccctgtactggagccacgaggccctgttccagaagaagactctgcaggcc
ctggaattccacactgtgcccttccagttgctggcccggtacaaaggcctgaacctcacc
gaggatacctacaagccccggatttacacctcgcccacctggagtgcctttgtgacagac
agttcctggagtgcacggaagtcacaactggtctatcagtccagacgggggcctttggtc
aaatattcttctgattacttccaagccccctctgactacagatactacccctaccagtcc
ttccagactccacaacaccccagcttcctcttccaggacaagagggtgtcctggtccctg
gtctacctccccaccatccagagctgctggaactacggcttctcctgctcctcggacgag
ctccctgtcctgggcctcaccaagtctggcggctcagatcgcaccattgcctacgaaaac
aaagccctgatgctctgcgaagggctcttcgtggcagacgtcaccgatttcgagggctgg
aaggctgcgattcccagtgccctggacaccaacagctcgaagagcacctcctccttcccc
tgcccggcagggcacttcaacggcttccgcacggtcatccgccccttctacctgaccaac
tcctcaggtgtggactag

DBGET integrated database retrieval system