KEGG   Homo sapiens (human): 396Help
Entry
396               CDS       T01001                                 

Gene name
ARHGDIA, GDIA1, HEL-S-47e, NPHS8, RHOGDI, RHOGDI-1
Definition
(RefSeq) Rho GDP dissociation inhibitor alpha
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
hsa04962  Vasopressin-regulated water reabsorption
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    396 (ARHGDIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    396 (ARHGDIA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    396 (ARHGDIA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   396 (ARHGDIA)
  Exosomal proteins of other body fluids (saliva and urine)
   396 (ARHGDIA)
  Exosomal proteins of colorectal cancer cells
   396 (ARHGDIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rho_GDI DUF4249
Motif
Other DBs
NCBI-GeneID: 396
NCBI-ProteinID: NP_001172006
OMIM: 601925
HGNC: 678
Ensembl: ENSG00000141522
Vega: OTTHUMG00000178352
Pharos: P52565(Tbio)
UniProt: P52565 V9HWE8
Structure
PDB: 

Position
17q25.3
AA seq 204 aa AA seqDB search
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSR
FTDDDKTDHLSWEWNLTIKKDWKD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggagcccacagccgagcagctggcccagattgcagcggagaacgaggag
gatgagcactcggtcaactacaagcccccggcccagaagagcatccaggagatccaggag
ctggacaaggacgacgagagcctgcgaaagtacaaggaggccctgctgggccgcgtggcc
gtttccgcagaccccaacgtccccaacgtcgtggtgactggcctgaccctggtgtgcagc
tcggccccgggccccctggagctggacctgacgggcgacctggagagcttcaagaagcag
tcgtttgtgctgaaggagggtgtggagtaccggataaaaatctctttccgggttaaccga
gagatagtgtccggcatgaagtacatccagcatacgtacaggaaaggcgtcaagattgac
aagactgactacatggtaggcagctatgggccccgggccgaggagtacgagttcctgacc
cccgtggaggaggcacccaagggtatgctggcccggggcagctacagcatcaagtcccgc
ttcacagacgacgacaagaccgaccacctgtcctgggagtggaatctcaccatcaagaag
gactggaaggactga

DBGET integrated database retrieval system