KEGG   Homo sapiens (human): 3960
Entry
3960              CDS       T01001                                 
Symbol
LGALS4, GAL4, L36LBP
Name
(RefSeq) galectin 4
  KO
K10091  galectin-4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    3960 (LGALS4)
Lectins [BR:hsa04091]
 S-type lectins (Galectins)
  3960 (LGALS4)
SSDB
Motif
Pfam: Gal-bind_lectin
Other DBs
NCBI-GeneID: 3960
NCBI-ProteinID: NP_006140
OMIM: 602518
HGNC: 6565
Ensembl: ENSG00000171747
Pharos: P56470(Tchem)
UniProt: P56470 Q6FHZ4
Structure
Position
19:complement(38801674..38812945)
AA seq 323 aa
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDV
AFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNP
FYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLP
TMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPR
MGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHR
LSAFQRVDTLEIQGDVTLSYVQI
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcctatgtccccgcaccgggctaccagcccacctacaacccgacgctgccttactac
cagcccatcccgggcgggctcaacgtgggaatgtctgtttacatccaaggagtggccagc
gagcacatgaagcggttcttcgtgaactttgtggttgggcaggatccgggctcagacgtc
gccttccacttcaatccgcggtttgacggctgggacaaggtggtcttcaacacgttgcag
ggcgggaagtggggcagcgaggagaggaagaggagcatgcccttcaaaaagggtgccgcc
tttgagctggtcttcatagtcctggctgagcactacaaggtggtggtaaatggaaatccc
ttctatgagtacgggcaccggcttcccctacagatggtcacccacctgcaagtggatggg
gatctgcaacttcaatcaatcaacttcatcggaggccagcccctccggccccagggaccc
ccgatgatgccaccttaccctggtcccggacattgccatcaacagctgaacagcctgccc
accatggaaggacccccaaccttcaacccgcctgtgccatatttcgggaggctgcaagga
gggctcacagctcgaagaaccatcatcatcaagggctatgtgcctcccacaggcaagagc
tttgctatcaacttcaaggtgggctcctcaggggacatagctctgcacattaatccccgc
atgggcaacggtaccgtggtccggaacagccttctgaatggctcgtggggatccgaggag
aagaagatcacccacaacccatttggtcccggacagttctttgatctgtccattcgctgt
ggcttggatcgcttcaaggtttacgccaatggccagcacctctttgactttgcccatcgc
ctctcggccttccagagggtggacacattggaaatccagggtgatgtcaccttgtcctat
gtccagatctaa

DBGET integrated database retrieval system