KEGG   Homo sapiens (human): 3964Help
Entry
3964              CDS       T01001                                 

Gene name
LGALS8, Gal-8, PCTA-1, PCTA1, Po66-CBP
Definition
(RefSeq) galectin 8
  KO
K06832  galectin-8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3964 (LGALS8)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    3964 (LGALS8)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    3964 (LGALS8)
Lectins [BR:hsa04091]
 S-type lectins (Galectins)
  3964 (LGALS8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin
Motif
Other DBs
NCBI-GeneID: 3964
NCBI-ProteinID: NP_963837
OMIM: 606099
HGNC: 6569
Ensembl: ENSG00000116977
Vega: OTTHUMG00000039953
Pharos: O00214(Tchem)
UniProt: O00214
Structure
PDB: 

Position
1q43
AA seq 317 aa AA seqDB search
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRA
DVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG
KHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT
PQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFV
RNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSI
DTLEINGDIHLLEVRSW
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgtccttaaacaacctacagaatatcatctataacccggtaatcccgtttgtt
ggcaccattcctgatcagctggatcctggaactttgattgtgatacgtgggcatgttcct
agtgacgcagacagattccaggtggatctgcagaatggcagcagcatgaaacctcgagcc
gatgtggcctttcatttcaatcctcgtttcaaaagggccggctgcattgtttgcaatact
ttgataaatgaaaaatggggacgggaagagatcacctatgacacgcctttcaaaagagaa
aagtcttttgagatcgtgattatggtgctgaaggacaaattccaggtggctgtaaatgga
aaacatactctgctctatggccacaggatcggcccagagaaaatagacactctgggcatt
tatggcaaagtgaatattcactcaattggttttagcttcagctcggacttacaaagtacc
caagcatctagtctggaactgacagagataagtagagaaaatgttccaaagtctggcacg
ccccagcttaggctgccattcgctgcaaggttgaacacccccatgggccctggacgaact
gtcgtcgttaaaggagaagtgaatgcaaatgccaaaagctttaatgttgacctactagca
ggaaaatcaaaggatattgctctacacttgaacccacgcctgaatattaaagcatttgta
agaaattcttttcttcaggagtcctggggagaagaagagagaaatattacctctttccca
tttagtcctgggatgtactttgagatgataatttattgtgatgttagagaattcaaggtt
gcagtaaatggcgtacacagcctggagtacaaacacagatttaaagagctcagcagtatt
gacacgctggaaattaatggagacatccacttactggaagtaaggagctggtag

DBGET integrated database retrieval system