KEGG   Homo sapiens (human): 3965Help
Entry
3965              CDS       T01001                                 

Gene name
LGALS9, HUAT, LGALS9A
Definition
(RefSeq) galectin 9
  KO
K10093  galectin-9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    3965 (LGALS9)
Lectins [BR:hsa04091]
 S-type lectins (Galectins)
  3965 (LGALS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin Peptidase_C62
Motif
Other DBs
NCBI-GeneID: 3965
NCBI-ProteinID: NP_033665
OMIM: 601879
HGNC: 6570
Ensembl: ENSG00000168961
Vega: OTTHUMG00000179831
Pharos: O00182(Tchem)
UniProt: O00182 A0A024QZ55
Structure
PDB: 

Position
17q11.2
AA seq 355 aa AA seqDB search
MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV
QYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQK
PPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKS
ILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPF
VRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccttcagcggttcccaggctccctacctgagtccagctgtccccttttctgggact
attcaaggaggtctccaggacggacttcagatcactgtcaatgggaccgttctcagctcc
agtggaaccaggtttgctgtgaactttcagactggcttcagtggaaatgacattgccttc
cacttcaaccctcggtttgaagatggagggtacgtggtgtgcaacacgaggcagaacgga
agctgggggcccgaggagaggaagacacacatgcctttccagaaggggatgccctttgac
ctctgcttcctggtgcagagctcagatttcaaggtgatggtgaacgggatcctcttcgtg
cagtacttccaccgcgtgcccttccaccgtgtggacaccatctccgtcaatggctctgtg
cagctgtcctacatcagcttccagaacccccgcacagtccctgttcagcctgccttctcc
acggtgccgttctcccagcctgtctgtttcccacccaggcccagggggcgcagacaaaaa
cctcccggcgtgtggcctgccaacccggctcccattacccagacagtcatccacacagtg
cagagcgcccctggacagatgttctctactcccgccatcccacctatgatgtacccccac
cccgcctatccgatgcctttcatcaccaccattctgggagggctgtacccatccaagtcc
atcctcctgtcaggcactgtcctgcccagtgctcagaggttccacatcaacctgtgctct
gggaaccacatcgccttccacctgaacccccgttttgatgagaatgctgtggtccgcaac
acccagatcgacaactcctgggggtctgaggagcgaagtctgccccgaaaaatgcccttc
gtccgtggccagagcttctcagtgtggatcttgtgtgaagctcactgcctcaaggtggcc
gtggatggtcagcacctgtttgaatactaccatcgcctgaggaacctgcccaccatcaac
agactggaagtggggggcgacatccagctgacccatgtgcagacatag

DBGET integrated database retrieval system