KEGG   Homo sapiens (human): 397
Entry
397               CDS       T01001                                 

Gene name
ARHGDIB, D4, GDIA2, GDID4, LYGDI, Ly-GDI, RAP1GN1, RhoGDI2
Definition
(RefSeq) Rho GDP dissociation inhibitor beta
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
hsa04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    397 (ARHGDIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    397 (ARHGDIB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    397 (ARHGDIB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   397 (ARHGDIB)
  Exosomal proteins of other body fluids (saliva and urine)
   397 (ARHGDIB)
  Exosomal proteins of colorectal cancer cells
   397 (ARHGDIB)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 397
NCBI-ProteinID: NP_001166
OMIM: 602843
HGNC: 679
Ensembl: ENSG00000111348
Vega: OTTHUMG00000168742
Pharos: P52566(Tbio)
UniProt: P52566 A0A024RAS5
Structure
PDB: 
5H1D 1DS6

Position
12p12.3
AA seq 201 aa
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVT
DPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIV
SGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTD
DDKQDHLSWEWNLSIKKEWTE
NT seq 606 nt   +upstreamnt  +downstreamnt
atgactgaaaaagccccagagccacatgtggaggaggatgacgatgatgagctggacagc
aagctcaattataagcctccaccacagaagtccctgaaagagctgcaggaaatggacaaa
gatgatgagagtctaattaagtacaagaaaacgctgctgggagatggtcctgtggtgaca
gatccgaaagcccccaatgtcgttgtcacccggctcaccctggtttgtgagagtgccccg
ggaccaatcaccatggaccttactggagatctggaagccctcaaaaaggaaaccattgtg
ttaaaggaaggttctgaatatagagtcaaaattcacttcaaagtgaacagggatattgtg
tcaggcctgaaatacgttcagcacacctacaggactggggtgaaagtggataaagcaaca
tttatggttggcagctatggacctcggcctgaggagtatgagttcctcactccagttgag
gaggctcccaagggcatgctggcgcgaggcacgtaccacaacaagtccttcttcaccgac
gatgacaagcaagaccacctcagctgggagtggaacctgtcgattaagaaggagtggaca
gaatga

DBGET integrated database retrieval system