KEGG   Homo sapiens (human): 3976Help
Entry
3976              CDS       T01001                                 

Gene name
LIF, CDF, DIA, HILDA, MLPLI
Definition
(RefSeq) LIF, interleukin 6 family cytokine
  KO
K05419  leukemia inhibitory factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  Jak-STAT signaling pathway
hsa04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3976 (LIF)
   04668 TNF signaling pathway
    3976 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3976 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3976 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3976 (LIF)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   3976 (LIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIF_OSM
Motif
Other DBs
NCBI-GeneID: 3976
NCBI-ProteinID: NP_002300
OMIM: 159540
HGNC: 6596
Ensembl: ENSG00000128342
Vega: OTTHUMG00000150910
Pharos: P15018(Tbio)
UniProt: P15018
Structure
PDB: 

Position
22q12.2
AA seq 202 aa AA seqDB search
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgttggttctgcactggaaacatggg
gcggggagccccctccccatcacccctgtcaacgccacctgtgccatacgccacccatgt
cacaacaacctcatgaaccagatcaggagccaactggcacagctcaatggcagtgccaat
gccctctttattctctattacacagcccagggggagccgttccccaacaacctggacaag
ctatgtggccccaacgtgacggacttcccgcccttccacgccaacggcacggagaaggcc
aagctggtggagctgtaccgcatagtcgtgtaccttggcacctccctgggcaacatcacc
cgggaccagaagatcctcaaccccagtgccctcagcctccacagcaagctcaacgccacc
gccgacatcctgcgaggcctccttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtgggccatgtggacgtgacctacggccctgacacctcgggtaaggatgtcttccagaag
aagaagctgggctgtcaactcctggggaagtataagcagatcatcgccgtgttggcccag
gccttctag

DBGET integrated database retrieval system