KEGG   Homo sapiens (human): 3984Help
Entry
3984              CDS       T01001                                 

Gene name
LIMK1, LIMK, LIMK-1
Definition
(RefSeq) LIM domain kinase 1
  KO
K05743  LIM domain kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06124  Chemokine signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3984 (LIMK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    3984 (LIMK1)
  09158 Development and regeneration
   04360 Axon guidance
    3984 (LIMK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    3984 (LIMK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3984 (LIMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3984 (LIMK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3984 (LIMK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   3984 (LIMK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LIM PDZ Kdo PDZ_6 APH Haspin_kinase RIO1 PDZ_4 Pkinase_fungal PDZ_2 PknG_TPR
Motif
Other DBs
NCBI-GeneID: 3984
NCBI-ProteinID: NP_002305
OMIM: 601329
HGNC: 6613
Ensembl: ENSG00000106683
Vega: OTTHUMG00000023448
Pharos: P53667(Tchem)
UniProt: P53667
Structure
PDB: 

Position
7q11.23
AA seq 647 aa AA seqDB search
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgacgctactttgttgcacctggagggaagaacgtatgggagaggaaggaagc
gagttgcccgtgtgtgcaagctgcggccagaggatctatgatggccagtacctccaggcc
ctgaacgcggactggcacgcagactgcttcaggtgttgtgactgcagtgcctccctgtcg
caccagtactatgagaaggatgggcagctcttctgcaagaaggactactgggcccgctat
ggcgagtcctgccatgggtgctctgagcaaatcaccaagggactggttatggtggctggg
gagctgaagtaccaccccgagtgtttcatctgcctcacgtgtgggacctttatcggtgac
ggggacacctacacgctggtggagcactccaagctgtactgcgggcactgctactaccag
actgtggtgacccccgtcatcgagcagatcctgcctgactcccctggctcccacctgccc
cacaccgtcaccctggtgtccatcccagcctcatctcatggcaagcgtggactttcagtc
tccattgaccccccgcacggcccaccgggctgtggcaccgagcactcacacaccgtccgc
gtccagggagtggatccgggctgcatgagcccagatgtgaagaattccatccacgtcgga
gaccggatcttggaaatcaatggcacgcccatccgaaatgtgcccctggacgagattgac
ctgctgattcaggaaaccagccgcctgctccagctgaccctcgagcatgaccctcacgat
acactgggccacgggctggggcctgagaccagccccctgagctctccggcttatactccc
agcggggaggcgggcagctctgcccggcagaaacctgtcttgaggagctgcagcatcgac
aggtctccgggcgctggctcactgggctccccggcctcccagcgcaaggacctgggtcgc
tctgagtccctccgcgtagtctgccggccacaccgcatcttccggccgtcggacctcatc
cacggggaggtgctgggcaagggctgcttcggccaggctatcaaggtgacacaccgtgag
acaggtgaggtgatggtgatgaaggagctgatccggttcgacgaggagacccagaggacg
ttcctcaaggaggtgaaggtcatgcgatgcctggaacaccccaacgtgctcaagttcatc
ggggtgctctacaaggacaagaggctcaacttcatcactgagtacatcaagggcggcacg
ctccggggcatcatcaagagcatggacagccagtacccatggagccagagagtgagcttt
gccaaggacatcgcatcagggatggcctacctccactccatgaacatcatccaccgagac
ctcaactcccacaactgcctggtccgcgagaacaagaatgtggtggtggctgacttcggg
ctggcgcgtctcatggtggacgagaagactcagcctgagggcctgcggagcctcaagaag
ccagaccgcaagaagcgctacaccgtggtgggcaacccctactggatggcacctgagatg
atcaacggccgcagctatgatgagaaggtggatgtgttctcctttgggatcgtcctgtgc
gagatcatcgggcgggtgaacgcagaccctgactacctgccccgcaccatggactttggc
ctcaacgtgcgaggattcctggaccgctactgccccccaaactgccccccgagcttcttc
cccatcaccgtgcgctgttgcgatctggaccccgagaagaggccatcctttgtgaagctg
gaacactggctggagaccctccgcatgcacctggccggccacctgccactgggcccacag
ctggagcagctggacagaggtttctgggagacctaccggcgcggcgagagcggactgcct
gcccaccctgaggtccccgactga

DBGET integrated database retrieval system