KEGG   Homo sapiens (human): 3985Help
Entry
3985              CDS       T01001                                 

Gene name
LIMK2
Definition
(RefSeq) LIM domain kinase 2
  KO
K05744  LIM domain kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3985 (LIMK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    3985 (LIMK2)
  Development
   04360 Axon guidance
    3985 (LIMK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3985 (LIMK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   3985 (LIMK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LIM PDZ Kdo APH PDZ_2
Motif
Other DBs
NCBI-GeneID: 3985
NCBI-ProteinID: NP_005560
OMIM: 601988
HGNC: 6614
Ensembl: ENSG00000182541
Vega: OTTHUMG00000151251
Pharos: P53671(Tchem)
UniProt: P53671 A0A024R1H6
Structure
PDB: 

Position
22q12.2
AA seq 638 aa AA seqDB search
MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYC
PKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPV
SQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPK
EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDS
FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgctggcgggtgaagatgtctggaggtgtccaggctgtggggaccacattgct
ccaagccagatatggtacaggactgtcaacgaaacctggcacggctcttgcttccggtgt
tcagaatgccaggattccctcaccaactggtactatgagaaggatgggaagctctactgc
cccaaggactactgggggaagtttggggagttctgtcatgggtgctccctgctgatgaca
gggccttttatggtggctggggagttcaagtaccacccagagtgctttgcctgtatgagc
tgcaaggtgatcattgaggatggggatgcatatgcactggtgcagcatgccaccctctac
tgtgggaagtgccacaatgaggtggtgctggcacccatgtttgagagactctccacagag
tctgttcaggagcagctgccctactctgtcacgctcatctccatgccggccaccactgaa
ggcaggcggggcttctccgtgtccgtggagagtgcctgctccaactacgccaccactgtg
caagtgaaagaggtcaaccggatgcacatcagtcccaacaatcgaaacgccatccaccct
ggggaccgcatcctggagatcaatgggacccccgtccgcacacttcgagtggaggaggtg
gaggatgcaattagccagacgagccagacacttcagctgttgattgaacatgaccccgtc
tcccaacgcctggaccagctgcggctggaggcccggctcgctcctcacatgcagaatgcc
ggacacccccacgccctcagcaccctggacaccaaggagaatctggaggggacactgagg
agacgttccctaaggcgcagtaacagtatctccaagtcccctggccccagctccccaaag
gagcccctgctgttcagccgtgacatcagccgctcagaatcccttcgttgttccagcagc
tattcacagcagatcttccggccctgtgacctaatccatggggaggtcctggggaagggc
ttctttgggcaggctatcaaggtgacacacaaagccacgggcaaagtgatggtcatgaaa
gagttaattcgatgtgatgaggagacccagaaaacttttctgactgaggtgaaagtgatg
cgcagcctggaccaccccaatgtgctcaagttcattggtgtgctgtacaaggataagaag
ctgaacctcctgacagagtacattgaggggggcacactgaaggactttctgcgcagtatg
gatccgttcccctggcagcagaaggtcaggtttgccaaaggaatcgcctccggaatggcc
tatttgcactctatgtgcatcatccaccgggatctgaactcgcacaactgcctcatcaag
ttggacaagactgtggtggtggcagactttgggctgtcacggctcatagtggaagagagg
aaaagggcccccatggagaaggccaccaccaagaaacgcaccttgcgcaagaacgaccgc
aagaagcgctacacggtggtgggaaacccctactggatggcccctgagatgctgaacgga
aagagctatgatgagacggtggatatcttctcctttgggatcgttctctgtgagatcatt
gggcaggtgtatgcagatcctgactgccttccccgaacactggactttggcctcaacgtg
aagcttttctgggagaagtttgttcccacagattgtcccccggccttcttcccgctggcc
gccatctgctgcagactggagcctgagagcagaccagcattctcgaaattggaggactcc
tttgaggccctctccctgtacctgggggagctgggcatcccgctgcctgcagagctggag
gagttggaccacactgtgagcatgcagtacggcctgacccgggactcacctccctag

DBGET integrated database retrieval system