KEGG   Homo sapiens (human): 399Help
Entry
399               CDS       T01001                                 

Gene name
RHOH, ARHH, TTF
Definition
(RefSeq) ras homolog family member H
  KO
K07873  Ras homolog gene family, member H
Organism
hsa  Homo sapiens (human)
Pathway
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    399 (RHOH)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    399 (RHOH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 SRPRB PduV-EutP TniB AAA_16 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 399
NCBI-ProteinID: NP_001265288
OMIM: 602037
HGNC: 686
Ensembl: ENSG00000168421
Vega: OTTHUMG00000099373
Pharos: Q15669(Tbio)
UniProt: Q15669 Q6ICP4
Position
4p14
AA seq 191 aa AA seqDB search
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTA
GNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQ
REMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR
RLFSINECKIF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgctgagttccatcaagtgcgtgttggtgggcgactctgctgtggggaaaacctctctg
ttggtgcgcttcacctccgagaccttcccggaggcctacaagcccacagtgtacgagaac
acaggggtggacgtcttcatggatggcatccagatcagcctgggcctctgggacacagcc
ggcaatgacgccttcagaagcatccggcccctgtcctaccagcaggcagacgtggtgctg
atgtgctactctgtggccaaccataactcattcctgaacttgaagaacaagtggattggt
gaaattaggagcaacttgccctgtacccctgtgctggtggtggccacccagactgaccag
cgggagatggggccccacagggcctcctgcgtcaatgccatggaagggaagaaactggcc
caggatgtcagagccaagggctacctggagtgctcagcccttagcaatcggggagtacag
caggtgtttgagtgcgccgtccgaactgccgtcaaccaggccaggagacgaaacagaagg
aggctcttctccatcaatgagtgcaagatcttctaa

DBGET integrated database retrieval system