KEGG   Homo sapiens (human): 399512
Entry
399512            CDS       T01001                                 

Gene name
SLC25A35
Definition
(RefSeq) solute carrier family 25 member 35
  KO
K15117  solute carrier family 25, member 34/35
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    399512 (SLC25A35)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   399512 (SLC25A35)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 399512
NCBI-ProteinID: NP_001307799
OMIM: 610818
HGNC: 31921
Ensembl: ENSG00000125434
Vega: OTTHUMG00000178480
Pharos: Q3KQZ1(Tdark)
UniProt: Q3KQZ1
Position
17p13.1
AA seq 300 aa
MDFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGLA
ALQKGLAPALLYQFLMNGIRLGTYGLAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLG
SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGS
STQLCTFSSTKDLLSQWEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQPTDA
QGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLYYTDTK
NT seq 903 nt   +upstreamnt  +downstreamnt
atggacttcttgatgagtggcctggcagcctgcggggcctgtgtattcaccaatcccctg
gaggtggtgaagaccaggatgcagttgcaaggagaactgcaggcccctggcacataccag
cggcactaccgaaatgtcttccatgccttcatcaccatcggcaaggtggatggccttgct
gccctgcagaaaggcctggcccccgccctcttgtaccagttcctgatgaatggcatccga
ctgggcacctatgggctggctgaggctgggggctacctgcacacagccgaaggcacccac
agtcctgcccgcagcgcagcagctggggccatggctggggtcatgggagcctacttgggg
agccccatctacatggtgaagacacacctgcaggcacaggcagcctcagaaattgctgta
gggcaccagtataagcatcagggcatgtttcaggcgctaaccgagattggccagaaacat
ggtctggtggggttatggcgtggggctctgggcggcctgccccgagttatcgtcggttcc
tccacccagctgtgcaccttctcatccaccaaggacctcctgagccagtgggagatcttt
cctccccagagctggaagttggcgctggtggctgccatgatgagtggcattgcagttgtc
ttggccatggcaccctttgatgtggcctgcacaaggctctacaaccagcccacagatgca
cagggcaagggcctcatgtaccgggggatactggacgctctgctgcagacagctcggacc
gagggcatttttggcatgtacaagggtataggtgcctcctacttccgcctcggcccccac
accatcctctccctcttcttctgggaccagctgcgctccctctactacacagacactaaa
taa

DBGET integrated database retrieval system