KEGG   Homo sapiens (human): 399694Help
Entry
399694            CDS       T01001                                 

Gene name
SHC4, RaLP, SHCD
Definition
(RefSeq) SHC adaptor protein 4
  KO
K17449  SHC-transforming protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04510  Focal adhesion
hsa04650  Natural killer cell mediated cytotoxicity
hsa04722  Neurotrophin signaling pathway
hsa04910  Insulin signaling pathway
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05034  Alcoholism
hsa05100  Bacterial invasion of epithelial cells
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05220  Chronic myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    399694 (SHC4)
   04012 ErbB signaling pathway
    399694 (SHC4)
   04072 Phospholipase D signaling pathway
    399694 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    399694 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    399694 (SHC4)
   04062 Chemokine signaling pathway
    399694 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    399694 (SHC4)
   04915 Estrogen signaling pathway
    399694 (SHC4)
   04917 Prolactin signaling pathway
    399694 (SHC4)
   04926 Relaxin signaling pathway
    399694 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    399694 (SHC4)
 09160 Human Diseases
  09161 Cancers
   05206 MicroRNAs in cancer
    399694 (SHC4)
   05225 Hepatocellular carcinoma
    399694 (SHC4)
   05226 Gastric cancer
    399694 (SHC4)
   05214 Glioma
    399694 (SHC4)
   05220 Chronic myeloid leukemia
    399694 (SHC4)
   05224 Breast cancer
    399694 (SHC4)
  09164 Substance dependence
   05034 Alcoholism
    399694 (SHC4)
  09167 Infectious diseases
   05100 Bacterial invasion of epithelial cells
    399694 (SHC4)
  09168 Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    399694 (SHC4)
   01522 Endocrine resistance
    399694 (SHC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 399694
NCBI-ProteinID: NP_976224
OMIM: 617372
HGNC: 16743
Ensembl: ENSG00000185634
Vega: OTTHUMG00000131513
Pharos: Q6S5L8(Tbio)
UniProt: Q6S5L8
Position
15q21.1
AA seq 630 aa AA seqDB search
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPH
PALAPHLPTEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSGPSSPETSLSRSGTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRH
FLQHLLGMGMNYCVRYMGCVEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
HIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGN
QRSAQPLGSPWHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPALLHSNK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaacgcggccaggacagcctggcaggactcgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtcgatcacgtcc
ttggacgaaggtagctccggaggctcggtcgggaacaagggctcgccgcagcctccccac
cccgccctggcacctcacctgccgactgaagatgccaccttgccgtcgcaggagagcccc
accccactgtgcaccttgatcccccgcatggcaagcatgaagctggccaacccggccact
ttgctgagtctgaaaaacttttgcctgggtaccaaagaggtgcctcggctgaagctccag
gaaagccgggacccaggttccagcggcccctcttccccagaaaccagtttaagtaggtcc
gggactgcacctccaccgcagcaggacctggtgggacacagggcaaccgccctaacccct
gattcgtgcccgcttcctggccctggggagccaacacttaggagcaggcaggacaggcac
tttctacagcacctgttggggatgggcatgaactactgtgtgaggtacatgggctgtgtt
gaagtgctgcaatcaatgagatcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacagtccttggcaaaagtaatcttcagttttcaggaatg
aatataaaactgaccatctcaacatgcagtctcacattgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgtcacatattg
gaatgccacaatggaatggcccaagacgtcataagtaccatagggcaggcttttgaactc
cggtttaaacagtacttgaaaaatccttctttgaatacttcttgtgaaagtgaggaggtg
catattgatagccatgccgaggagagagaagatcatgaatattacaatgaaattccaggg
aagcagccaccagtaggtggtgtttcagatatgcggatcaaagttcaagccacggaacaa
atggcttactgccccatacagtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtttagaacaaagcagggcaataggtaatgtccatccaaga
ggggtgcagtcccagcgagatacctcattattgaagcacacgtgccgagtggatctcttt
gatgacccctgctacattaatacacaggctcttcaaagtacacctggctctgctggaaat
caaaggtcagcccaaccactggggagcccatggcactgcggaaaggcaccagaaactgtt
cagccgggtgccacagcccagcctgccagctcacattctttgccacacattaagcagcag
ctgtggagcgaagaatgctatcatggcaagctgagcaggaaggcggcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacatcccctggccaatatgtgctg
agtggactacagggaggccaagcaaaacatcttctcctggtggatcctgaaggcaaggtg
aggaccaaggatcatgtatttgataatgtcggccaccttatcagataccatatggataac
agtttgccaatcatctcctctggaagcgaagtaagccttaaacaaccagtgagaaaagat
aataatccagcacttttgcattccaacaaatga

DBGET integrated database retrieval system