KEGG   Homo sapiens (human): 3998Help
Entry
3998              CDS       T01001                                 

Gene name
LMAN1, ERGIC-53, ERGIC53, F5F8D, FMFD1, MCFD1, MR60, gp58
Definition
(RefSeq) lectin, mannose binding 1
  KO
K10080  lectin, mannose-binding 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00221  Combined deficiency of factors V and VIII
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3998 (LMAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3998 (LMAN1)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    3998 (LMAN1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    3998 (LMAN1)
Lectins [BR:hsa04091]
 L-type lectins
  3998 (LMAN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_leg-like Bact_lectin Lectin_legB Golgin_A5 FAM176
Motif
Other DBs
NCBI-GeneID: 3998
NCBI-ProteinID: NP_005561
OMIM: 601567
HGNC: 6631
Ensembl: ENSG00000074695
Vega: OTTHUMG00000132758
Pharos: P49257(Tbio)
UniProt: P49257 A0A024R2A7
Structure
PDB: 

Position
18q21.32
AA seq 510 aa AA seqDB search
MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQS
DGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGA
DGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQN
DGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPA
QGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQEL
DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQR
RYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGM
QHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVH
FIIFVVVQTVLFIGYIMYRSQQEAAAKKFF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatccaggcaaaggggtctccgggccagagttcggccgctgttctgcgccttg
ctgctgtcactcggtcgcttcgtccggggcgacggcgtgggaggagaccccgcggtcgcg
ttgccacatcgccgtttcgagtacaaatacagcttcaaggggccgcacctggtgcagagc
gacgggaccgtgcccttctgggcccacgcggggaatgctattccaagttcagatcaaatt
cgagtagcaccatctttaaaaagccaaagaggctcagtgtggacaaagacaaaagcggcc
tttgagaactgggaagttgaggtgacatttcgagtgactggaagaggtcgaattggagct
gatggcctagcaatttggtatgcagaaaatcaaggcttggagggccctgtgtttggatca
gctgatctgtggaatggtgttggaatattttttgattcttttgacaatgatggaaagaaa
aataatcctgctatagtaattataggcaacaatggacaaatccattatgaccatcaaaat
gacggggctagtcaagctttggcaagttgccagagggacttccgcaacaaaccctatcct
gtccgagcaaagattacctattaccagaacacactgacagtaatgatcaataatggcttt
acaccagataaaaatgattatgaattttgtgccaaagtggaaaatatgattatccctgca
caagggcattttggaatatctgctgcaactggaggtcttgcagatgaccatgatgtcctt
tcttttctgactttccagttgactgaacctggaaaagagccgcccacaccagataaagaa
atttcggaaaaggaaaaagaaaagtatcaggaggaatttgagcactttcaacaagaattg
gataaaaaaaaagaggaattccagaagggccaccccgacctccaagggcagcctgcggag
gaaatatttgagagtgtaggagatcgagagctaagacaagtctttgaaggacagaatcgt
attcatcttgaaatcaagcagctgaaccggcagttagatatgattcttgatgaacagaga
agatatgtctcttccttaacagaggaaatctctaaaagaggagcaggaatgcctgggcag
catgggcagattactcaacaagaactggatactgttgtgaaaactcagcatgagattctg
agacaagtaaatgaaatgaaaaattccatgagtgaaaccgtcagactggtcagtggaatg
cagcaccctggctctgctggaggcgtctatgagacaacacagcacttcattgacatcaaa
gagcacctgcacatagtaaagagggacatagataacttagtgcagcgaaatatgccatca
aatgaaaagccgaaatgcccagaactaccaccatttccatcatgtttgtctacggtccac
ttcattatatttgttgtggtgcaaactgtattattcattggttatatcatgtataggtct
cagcaagaagcagctgccaaaaaattcttttga

DBGET integrated database retrieval system