KEGG   Homo sapiens (human): 399814
Entry
399814            CDS       T01001                                 

Gene name
C10orf120, bA318C4.1
Definition
(RefSeq) chromosome 10 open reading frame 120
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5520 PBP1_TM DUF1039
Other DBs
NCBI-GeneID: 399814
NCBI-ProteinID: NP_001010912
HGNC: 25707
Ensembl: ENSG00000183559
Vega: OTTHUMG00000019187
Pharos: Q5SQS8(Tdark)
UniProt: Q5SQS8
Position
10q26.13
AA seq 335 aa
MIREWKNDCQRIEKQRASDTMVQERKNEKPVRIFNTNSSFQDQAPTCCQEDLSSASPLRI
WSKFYRSDPRIALGKYSPLEKEILRLGGIHTIAARRLLAYKQEEECRMLKELQLLSPDYK
QAMEYKKKHSSPCAICVPLEKIWTAKVIAPLEAFKMPQREQVNVSKHIERMRLARALGNH
QPLPYIERFTRSSFLSGVGLGPMAKNKARRKEDNYDTHNCDDANQDKKEEAEGKNTKRRE
IKMNVVFKSKEPKKCLTYHGNDRKSFLPAKKPERSIAGLTNRNLFCISEFPGDLMLMNQD
FISRRDHFSDLVKTYSLEEESIWKERMRKATPYHY
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgatcagagaatggaagaatgactgtcagaggattgaaaaacagagggctagtgacaca
atggtgcaagaaaggaagaatgaaaagccagttagaatatttaataccaactcttccttt
caggatcaagccccaacgtgttgccaagaggatctgagttctgcttcaccgttgcggata
tggagcaaattctacagatcagacccacggattgcccttgggaaatactcccccttggaa
aaagagatcctacgtctaggtggcattcacaccatagcagcaagaaggcttttggcttac
aagcaagaggaagaatgcagaatgctcaaggaactacagttgctgtctccggactacaaa
caagcaatggagtataaaaagaaacattcctctccttgtgctatttgtgtacccctagaa
aaaatatggacagcaaaggtgattgcgcccctggaggcatttaaaatgccacaacgagag
caggtgaacgtcagtaagcacatagagaggatgaggcttgctcgggctctgggaaatcat
cagcctttaccctacattgaaaggtttacacgctcctcatttctgtctggggtgggcctg
ggtccaatggcaaaaaataaggccagacgaaaggaagacaactatgacacccataattgt
gatgatgccaaccaagataagaaagaggaggcagagggaaaaaacacaaaaagacgagaa
ataaaaatgaatgtagttttcaagtcaaaagaaccaaaaaaatgtttaacataccatgga
aatgatcgcaaatcattcctccccgcaaagaaaccggaacggtccatcgcaggcctaaca
aaccgaaatcttttctgcatatcagaattccctggtgacttaatgctaatgaatcaggat
tttatatcacggagagaccacttcagtgatctggtcaagacctacagcctggaagaagag
agtatctggaaagagcgcatgcgtaaagcaactccttatcattattaa

DBGET integrated database retrieval system