KEGG   Homo sapiens (human): 399818
Entry
399818            CDS       T01001                                 

Gene name
EEF1AKMT2, C10orf138, Efm4, METTL10
Definition
(RefSeq) EEF1A lysine methyltransferase 2
  KO
K22856  EEF1A lysine methyltransferase 2 [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    399818 (EEF1AKMT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     399818 (EEF1AKMT2)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    399818 (EEF1AKMT2)
SSDB
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 PrmA MTS Methyltransf_4 CMAS TehB TPMT Spermine_synth Methyltransf_20 PCMT NodS
Other DBs
NCBI-GeneID: 399818
NCBI-ProteinID: NP_997719
OMIM: 617794
HGNC: 33787
Ensembl: ENSG00000203791
Vega: OTTHUMG00000019217
Pharos: Q5JPI9(Tdark)
UniProt: Q5JPI9 Q8TC28
Position
10q26.13
AA seq 291 aa
MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWF
GEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGS
IIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRV
LKVKGFFLITSCNWTKEELLNEFSEGWSTVAGFWLTAALTSWAQAIFSTSASRVGGTTGT
HHHAWIIFVFLAETRFCHVVQAGLELLGSSDSPTWPPKVLGLYHARPSLAF
NT seq 876 nt   +upstreamnt  +downstreamnt
atgagctcgggcgctgacggcggcggtggcgctgcggtggcggcgcggtcggacaagggc
agtcccggggaggacggtttcgtcccgtcggcgctggggacccgcgagcattgggatgct
gtctatgagagagaactgcaaactttccgagaatatggagatacaggtgaaatctggttt
ggagaagagagtatgaatcgactaataaggtggatgcagaaacacaagattccactggat
gcttcagtgcttgatattggaactggaaatggtgttttcctggttgaacttgcaaaattt
ggtttctctaatattactggaattgattactctccttctgcaattcagctttctggaagt
attatagaaaaagaaggtttatctaacattaagttaaaggtagaagactttttgaatctc
tccacacagctgtctggatttcatatttgtattgacaaagggacttttgatgccataagc
cttaatcctgacaatgcaattgagaagaggaagcaatatgtgaaatctctctccagggtg
ttgaaagtaaaaggcttttttctaataacgtcatgtaattggaccaaggaagagttgcta
aatgaattcagtgaaggttggagtacagtggcaggattttggctcactgcagccttgact
tcctgggctcaagcgatcttttccacttcagcctcccgagtaggtggaactacaggcaca
catcatcatgcctggataatttttgtatttttagcagagacgaggttttgccatgttgtc
caggctggtctggaactcctgggctcaagtgattctcccacctggcctcccaaagtgctg
ggattataccatgccaggccctcgttggcattttag

DBGET integrated database retrieval system